Description

  • Product name

    Recombinant Human ENO3 protein
  • Biological activity

    Specific activity is > 5,000pmol/min/µg, and was obtained by measuring the decrease of NAD in absorbance at 340nm resulting from NADH at pH 6.5 at 37°C.

  • Purity

    > 95 % SDS-PAGE.
    ab113127 was purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAMQKIFAREILDSRGNPTVEVDLHTAKGR FRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENINSTLGPALLQK KLSVADQEKVDKFMIELDGTENKSKFGANAILGVSLAVCKAGAAEKGVPL YRHIADLAGNPDLILPVPAFNVINGGSHAGNKLAMQEFMILPVGASSFKE AMRIGAEVYHHLKGVIKAKYGKDATNVGDEGGFAPNILENNEALELLKTA IQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDLTVTNPKRIAQ AVEKKACNCLLLKVNQIGSVTESIQACKLAQSNGWGVMVSHRSGETEDTF IADLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEALGDKAIFAGRKFRN PKAK
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      1 to 434
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113127 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 20% Glycerol, 0.58% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 2 phospho D glycerate hydro lyase
    • 2 phospho D glycerate hydrolyase
    • 2-phospho-D-glycerate hydro-lyase
    • Beta enolase
    • Beta-enolase
    • ENO3
    • ENOB_HUMAN
    • Enolase 3
    • Enolase 3 (beta muscle)
    • Enolase3
    • GSD13
    • MSE
    • Muscle specific enolase
    • Muscle-specific enolase
    • Skeletal muscle enolase
    see all
  • Function

    Appears to have a function in striated muscle development and regeneration.
  • Tissue specificity

    The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons.
  • Pathway

    Carbohydrate degradation; glycolysis; pyruvate from D-glyceraldehyde 3-phosphate: step 4/5.
  • Involvement in disease

    Defects in ENO3 are the cause of glycogen storage disease type 13 (GSD13) [MIM:612932]. A metabolic disorder that results in exercise-induced myalgias, generalized muscle weakness and fatigability. It is characterized by increased serum creatine kinase and decreased enolase 3 activity. Dramatically reduced protein levels with focal sarcoplasmic accumulation of glycogen-beta particles are detected on ultrastructural analysis.
  • Sequence similarities

    Belongs to the enolase family.
  • Developmental stage

    During ontogenesis, there is a transition from the alpha/alpha homodimer to the alpha/beta heterodimer in striated muscle cells, and to the alpha/gamma heterodimer in nerve cells.
  • Cellular localization

    Cytoplasm. Localized to the Z line. Some colocalization with CKM at M-band.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ENO3 protein (ab113127; 3 µg).

References

ab113127 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113127.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up