Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQ GRPSPGPPAPEQLLSQARDFINQYYSSIKRSGSQAHEQRLQEVEAEVAAT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      61 to 160
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • cNOS
    • Constitutive NOS
    • EC NOS
    • EC-NOS
    • ecNOS
    • Endothelial nitric oxidase synthase
    • Endothelial nitric oxide synthase
    • Endothelial nitric oxide synthase 3
    • Endothelial NOS
    • eNOS
    • Nitric oxide synthase 3
    • Nitric oxide synthase 3 (endothelial cell)
    • Nitric oxide synthase 3 endothelial cell
    • Nitric oxide synthase endothelial
    • Nitric oxide synthase, endothelial
    • NOS 3
    • NOS III
    • NOS type III
    • NOS3
    • NOS3_HUMAN
    • NOSIII
    see all
  • Function
    Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.
    Isoform eNOS13C: Lacks eNOS activity, dominant-negative form that may down-regulate eNOS activity by forming heterodimers with isoform 1.
  • Tissue specificity
    Platelets, placenta, liver and kidney.
  • Involvement in disease
    Variation in NOS3 seem to be associated with susceptibility to coronary spasm.
  • Sequence similarities
    Belongs to the NOS family.
    Contains 1 FAD-binding FR-type domain.
    Contains 1 flavodoxin-like domain.
  • Post-translational
    modifications
    Phosphorylation by AMPK at Ser-1177 in the presence of Ca(2+)-calmodulin (CaM) activates activity. In absence of Ca(2+)-calmodulin, AMPK also phosphorylates Thr-495, resulting in inhibition of activity (By similarity). Phosphorylation of Ser-114 by CDK5 reduces activity.
  • Cellular localization
    Cell membrane. Membrane, caveola. Cytoplasm, cytoskeleton. Golgi apparatus. Specifically associates with actin cytoskeleton in the G2 phase of the cell cycle and which is favored by interaction with NOSIP and results in a reduced enzymatic activity.
  • Information by UniProt

Images

  • ab112329 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us.

We have:

DDAH1 protein (https://www.abcam.com/ab99863), Recombinant full length Human DDAH1 (amino acids 1-285) with an N terminal His tag.
DDAH2 protein (Tagged-His Tag) (https://www.abcam.com/ab92017), Recombinant fragment, corresponding to amino acids 71-261 (191 amino acids) of Human DDAH2 with N terminal His tag.



For eNOS, the only 2 products we have are:

The protein fragment https://www.abcam.com/ab112329, corresponding to amino acids 61-160 of Human eNOS with a proprietary tag.
The peptide https://www.abcam.com/ab109090, immunogen for ab95254.



The 2 eNOS products are not phosphorylated.


I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up