Description

  • Product name

    Recombinant Human eNOS protein (Tagged)
    See all eNOS proteins and peptides
  • Purity

    >= 71 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHHHHHHDYKDDDDKGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAP EPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSA QAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAPEQLLSQARDFINQYYS SIKRSGSQAHEQRLQEVEAEVAATGTYQLRESELVFGAKQAWRNAPRCVG RIQWGKLQVFDARDCRSAQEMFTYICNHIKYATNRGNLRSAITVFPQRCP GRGDFRIWNSQLVRYAGYRQQDGSVRGDPANVEITELCIQHGWTPGNGRF DVLPLLLQAPDDPPELFLLPPELVLEVPLEHPTLEWFAALGLRWYALPAV SNMLLEIGGLEFPAAPFSGWYMSTEIGTRNLCDPHRYNILEDVAVCMDLD TRTTSSLWKDKAAVEINVAVLHSYQLAKVTIVDHHAATASFMKHLENEQK ARGGCPADWAWIVPPISGSLTPVFHQEMVNYFLSPAFRYQPDPWKGSAAK GTGITRKKTFKEVANAVKISASLMGTVMAKRVKATILYGSETGRAQSYAQ QLGRLFRKAFDPRVLCMDEYDVVSLEHETLVLVVTSTFGNGDPPENGESF AAALMEMSGPYNSSPRPEQHKSYKIRFNSISCSDPLVSSWRRKRKESSNT DSAGALGTLRFCVFGLGSRAYPHFCAFARAVDTRLEELGGERLLQLGQGD ELCGQEEAFRGWAQAAFQAACETFCVGEDAKAAARDIFSPKRSWKRQRYR LSAQAEGLQLLPGLIHVHRRKMFQATIRSVENLQSSKSTRATILVRLDTG GQEGLQYQPGDHIGVCPPNRPGLVEALLSRVEDPPAPTEPVAVEQLEKGS PGGPPPGWVRDPRLPPCTLRQALTFFLDITSPPSPQLLRLLSTLAEEPRE QQELEALSQDPRRYEEWKWFRCPTLLEVLEQFPSVALPAPLLLTQLPLLQ PRYYSVSSAPSTHPGEIHLTVAVLAYRTQDGLGPLHYGVCSTWLSQLKPG DPVPCFIRGAPSFRLPPDPSLPCILVGPGTGIAPFRGFWQERLHDIESKG LQPTPMTLVFGCRCSQLDHLYRDEVQNAQQRGVFGRVLTAFSREPDNPKT YVQDILRTELAAEVHRVLCLERGHMFVCGDVTMATNVLQTVQRILATEGD MELDEAGDVIGVLRDQQRYHEDIFGLTLRTQEVTSRIRTQSFSLQERQLR GAVPWAFDPPGSDTNSP
    • Predicted molecular weight

      135 kDa including tags
    • Amino acids

      2 to 1203
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 2 to 1203. The initial Met is not included. GenBank Accession No. NM_000603.

Specifications

Our Abpromise guarantee covers the use of ab198066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Preservative: 1.77% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

General Info

  • Alternative names

    • cNOS
    • Constitutive NOS
    • EC NOS
    • EC-NOS
    • ecNOS
    • Endothelial nitric oxidase synthase
    • Endothelial nitric oxide synthase
    • Endothelial nitric oxide synthase 3
    • Endothelial NOS
    • eNOS
    • Nitric oxide synthase 3
    • Nitric oxide synthase 3 (endothelial cell)
    • Nitric oxide synthase 3 endothelial cell
    • Nitric oxide synthase endothelial
    • Nitric oxide synthase, endothelial
    • NOS 3
    • NOS III
    • NOS type III
    • NOS3
    • NOS3_HUMAN
    • NOSIII
    see all
  • Function

    Produces nitric oxide (NO) which is implicated in vascular smooth muscle relaxation through a cGMP-mediated signal transduction pathway. NO mediates vascular endothelial growth factor (VEGF)-induced angiogenesis in coronary vessels and promotes blood clotting through the activation of platelets.
    Isoform eNOS13C: Lacks eNOS activity, dominant-negative form that may down-regulate eNOS activity by forming heterodimers with isoform 1.
  • Tissue specificity

    Platelets, placenta, liver and kidney.
  • Involvement in disease

    Variation in NOS3 seem to be associated with susceptibility to coronary spasm.
  • Sequence similarities

    Belongs to the NOS family.
    Contains 1 FAD-binding FR-type domain.
    Contains 1 flavodoxin-like domain.
  • Post-translational
    modifications

    Phosphorylation by AMPK at Ser-1177 in the presence of Ca(2+)-calmodulin (CaM) activates activity. In absence of Ca(2+)-calmodulin, AMPK also phosphorylates Thr-495, resulting in inhibition of activity (By similarity). Phosphorylation of Ser-114 by CDK5 reduces activity.
  • Cellular localization

    Cell membrane. Membrane, caveola. Cytoplasm, cytoskeleton. Golgi apparatus. Specifically associates with actin cytoskeleton in the G2 phase of the cell cycle and which is favored by interaction with NOSIP and results in a reduced enzymatic activity.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of 1.6 µg ab198066 with Coomassie staining.

References

ab198066 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up