Description

  • Product name

    Recombinant Human ENOX1 protein (His tag)
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MVDAGGVENITQLPQELPQMMAAAADGLGSIAIDTTQLNMSVTDPTAWAT AMNNLGMVPVGLPGQQLVSDSICVPGFDPSLNMMTGITPINPMIPGLGLV PPPPPTEVAVVKEIIHCKSCTLFPQNPNLPPPSTRERPPGCKTVFVGGLP ENATEEIIQEVFEQCGDITAIRKSKKNFCHIRFAEEFMVDKAIYLSGYRM RLGSSTDKKDSGRLHVDFAQARDDFYEWECKQRMRAREERHRRKLEEDRL RPPSPPAIMHYSEHEAALLAEKLKDDSKFSEAITVLLSWIERGEVNRRSA NQFYSMVQSANSHVRRLMNEKATHEQEMEEAKENFKNALTGILTQFEQIV AVFNASTRQKAWDHFSKAQRKNIDIWRKHSEELRNAQSEQLMGIRREEEM EMSDDENCDSPTKKMRVDESALAAQAYALKEENDSLRWQLDAYRNEVELL KQEKEQLFRTEENLTKDQQLQFLQQTMQGMQQQLLTIQEELNNKKSELEQ AKEEQSHTQALLKVLQEQLKGTKELVETNGHSHEDSNEINVLTVALVNQD RENNIEKRSQGLKSEKEALLIGIISTFLHVHPFGANIEYLWSYMQQLDSK ISANEIEMLLMRLPRMFKQEFTGVGATLEKRWKLCAFEGIKTT
    • Predicted molecular weight

      77 kDa including tags
    • Amino acids

      1 to 643
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab235676 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • bA64J21.1
    • candidate growth related and time keeping constitutive hydroquinone (NADH) oxidase
    • Candidate growth related and time keeping constitutive hydroquinone [NADH] oxidase
    • Candidate growth-related and time keeping constitutive hydroquinone [NADH] oxidase
    • cCNOX
    • Cell proliferation inducing gene 38 protein
    • Cell proliferation-inducing gene 38 protein
    • cNOX
    • Constitutive Ecto NOX
    • Constitutive Ecto-NOX
    • Ecto NOX disulfide thiol exchanger 1
    • ENOX1
    • ENOX1_HUMAN
    • FLJ10094
    • OTTHUMP00000018332
    • PIG38
    • Proliferation inducing protein 38
    • Protein disulfide-thiol oxidoreductase
    see all
  • Function

    Probably acts as a terminal oxidase of plasma electron transport from cytosolic NAD(P)H via hydroquinones to acceptors at the cell surface. Hydroquinone oxidase activity alternates with a protein disulfide-thiol interchange/oxidoreductase activity which may control physical membrane displacements associated with vesicle budding or cell enlargement. The activities oscillate with a period length of 24 minutes and play a role in control of the ultradian cellular biological clock.
  • Tissue specificity

    Expressed in lymphocyte cells, breast and breast cancer (at protein level). Found in the sera of cancer patients with a wide variety of cancers including breast, prostate, lung and ovarian cancers, leukemias, and lymphomas. Found also in the serum of healthy volunteers or patients with disorders other than cancer. Probably shed into serum by cancer cells.
  • Sequence similarities

    Belongs to the ENOX family.
    Contains 1 RRM (RNA recognition motif) domain.
  • Cellular localization

    Cell membrane. Secreted > extracellular space. Extracellular and plasma membrane-associated.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) analysis with 5% enrichment gel and 15% separation gel of ab235676.

References

ab235676 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235676.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up