Description

  • Product name

    Recombinant Human ENSA protein (His tag)
    See all ENSA proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGS DFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPD LPQRKSSLVTSKLAGGQVE
    • Predicted molecular weight

      14 kDa including tags
    • Amino acids

      2 to 121
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (AAH00436).

Specifications

Our Abpromise guarantee covers the use of ab219690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 95% PBS

    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Alpha endosulfine
    • ARPP 19e
    • Endosulfine alpha
  • Relevance

    ENSA (Alpha endosulfine) is expressed in a wide range of tissues including muscle, brain, and endocrine tissues. The recombinant protein inhibits binding of labeled glibenclamide to beta cell membranes. It also inhibits cloned K(ATP) channel currents and thereby stimulates insulin secretion. It was proposed that endosulfine is an endogenous regulator of the K(ATP) channel, which has a key role in the control of insulin release and, more generally, couples cell metabolism to electrical activity.
  • Cellular localization

    Cytoplasmic

Images

  • SDS-PAGE analysis of DTT-reduced ab219690 stained overnight with Coomassie Blue. DTT-reduced protein migrates as 18 kDa.

References

ab219690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up