Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      EGLQYPFAVTSYGKNLYFTDWKMNSVVALDLAISKETDAFQPHKQTRLYG ITTALSQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIERK
    • Amino acids

      1148 to 1247
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Entactin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Enactin
    • Ent
    • Entactin
    • Entactin 1
    • NID
    • NID 1
    • NID-1
    • Nid1
    • NID1_HUMAN
    • Nidogen
    • Nidogen (enactin)
    • Nidogen 1
    • Nidogen-1
    see all
  • Function

    Sulfated glycoprotein widely distributed in basement membranes and tightly associated with laminin. Also binds to collagen IV and perlecan. It probably has a role in cell-extracellular matrix interactions.
  • Sequence similarities

    Contains 6 EGF-like domains.
    Contains 4 LDL-receptor class B repeats.
    Contains 1 NIDO domain.
    Contains 1 nidogen G2 beta-barrel domain.
    Contains 1 thyroglobulin type-1 domain.
  • Post-translational
    modifications

    N- and O-glycosylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt

Images

  • ab158997 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up