Description

  • Product name

    Recombinant human Enterokinase protein (Animal Free)
    See all Enterokinase proteins and peptides
  • Biological activity

    Sequentially cleaves carboxyl side of D-D-D-D-K.

  • Purity

    >= 90 % SDS-PAGE.
    >= 90% by HPLC analysis.
  • Endotoxin level

    < 0.200 Eu/µg
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      Heavy chain (aa41-784): LTIKESQRGAALGQSHEARATFKITSGVTYNPNLQDK LSVDFKVLAFDLQQMIDEIFLSSNLKNEYKNSRVLQFENGSIIVVFDLFF AQWVSDQNVKEELIQGLEANKSSQLVTFHIDLNSVDILDKLTTTSHLATP GNVSIECLPGSSPCTDALTCIKADLFCDGEVNCPDGSDEDNKMCATVCDG RFLLTGSSGSFQATHYPKPSETSVVCQWIIRVNQGLSIKLSFDDFNTYYT DILDIYEGVGSSKILRASIWETNPGTIRIFSNQVTATFLIESDESDYVGF NATYTAFNSSELNNYEKINCNFEDGFCFWVQDLNDDNEWERIQGSTFSPF TGPNFDHTFGNASGFYISTPTGPGGRQERVGLLSLPLDPTLEPACLSFWY HMYGENVHKLSINISNDQNMEKTVFQKEGNYGDNWNYGQVTLNETVKFKV AFNAFKNKILSDIALDDISLTYGICNGSLYPEPTLVPTPPPELPTDCGGP FELWEPNTTFSSTNFPNSYPNLAFCVWILNAQKGKNIQLHFQEFDLENIN DVVEIRDGEEADSLLLAVYTGPGPVKDVFSTTNRMTVLLITNDVLARGGF KANFTTGYHLGIPEPCKADHFQCKNGECVPLVNLCDGHLHCEDGSDEADC VRFFNGTTNNNGLVRFRIQSIWHTACAENWTTQISNDVCQLLGLGSGNSS KPIFSTDGGPFVKLNTAPDGHLILTPSQQCLQDSLIRLQCNHKSCGKKLA AQDITPK Light chain (aa785-1019): IVGGSNAKEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAAHCVYGRNLEP SKWTAILGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHLEF KVNYTDYIQPICLPEENQVFPPGRNCSIAGWGTVVYQGTTANILQEADVP LLSNERCQQQMPEYNITENMICAGYEEGGIDSCQGDSGGPLMCQENNRWF LAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFLH
    • Predicted molecular weight

      109 kDa
    • Amino acids

      41 to 1019

Associated products

Specifications

Our Abpromise guarantee covers the use of ab234498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • PRSS 7
    • PRSS7
    • Enterokinase
    • Enterokinase catalytic subunit
    • Enteropeptidase
    • Enteropeptidase catalytic light chain
    • Enteropeptidase non catalytic heavy chain
    • ENTK
    • ENTK_HUMAN
    • PROENTEROKINASE
    • protease, serine, 7 (enterokinase)
    • PRSS7
    • Serine protease 7
    • TMPRSS15
    • Transmembrane protease serine 15
    see all
  • Function

    Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.
  • Tissue specificity

    Intestinal brush border.
  • Involvement in disease

    Defects in TMPRSS15 are a cause of enterokinase deficiency (ENTKD) [MIM:226200]; a life-threatening intestinal malabsorption disorder characterized by diarrhea and failure to thrive.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 2 CUB domains.
    Contains 2 LDL-receptor class A domains.
    Contains 1 MAM domain.
    Contains 1 peptidase S1 domain.
    Contains 1 SEA domain.
    Contains 1 SRCR domain.
  • Post-translational
    modifications

    The chains are derived from a single precursor that is cleaved by a trypsin-like protease.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab234498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up