Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAIVGGSNAKEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAAHCVYGRNL EPSKWTAILGLHMKSNLTSPQTVPRLIDEIVINPHYNRRRKDNDIAMMHL EFKVNYTDYIQPICLPEENQVFPPGRNCSIAGWGTVVYQGTTANILQEAD VPLLSNERCQQQMPEYNITENMICAGYEEGGIDSCQGDSGGPLMCQENNR WFLAGVTSFGYKCALPNRPGVYARVSRFTEWIQSFLH
    • Molecular weight

      26 kDa
    • Amino acids

      785 to 1019
    • Additional sequence information

      Corresponding to Enteropeptidase catalytic light chain. NP_002763.

Specifications

Our Abpromise guarantee covers the use of ab202157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.
    ab202157 was purified by conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • PRSS 7
    • PRSS7
    • Enterokinase
    • Enterokinase catalytic subunit
    • Enteropeptidase
    • Enteropeptidase catalytic light chain
    • Enteropeptidase non catalytic heavy chain
    • ENTK
    • ENTK_HUMAN
    • PROENTEROKINASE
    • protease, serine, 7 (enterokinase)
    • PRSS7
    • Serine protease 7
    • TMPRSS15
    • Transmembrane protease serine 15
    see all
  • Function

    Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.
  • Tissue specificity

    Intestinal brush border.
  • Involvement in disease

    Defects in TMPRSS15 are a cause of enterokinase deficiency (ENTKD) [MIM:226200]; a life-threatening intestinal malabsorption disorder characterized by diarrhea and failure to thrive.
  • Sequence similarities

    Belongs to the peptidase S1 family.
    Contains 2 CUB domains.
    Contains 2 LDL-receptor class A domains.
    Contains 1 MAM domain.
    Contains 1 peptidase S1 domain.
    Contains 1 SEA domain.
    Contains 1 SRCR domain.
  • Post-translational
    modifications

    The chains are derived from a single precursor that is cleaved by a trypsin-like protease.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202157 (3µg).

References

ab202157 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202157.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up