Description

  • Product name

    Recombinant Human ENTPD3 protein (His tag)
    See all ENTPD3 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab219293 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADLQIHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTF KCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATA GMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITA NYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTS DIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCY PRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVAS IFDFKACHDQETCSFDGVYQPKIKGPFVAFAGFYYTASALNLSGSFSLDT FNSSTWNFCSQNWSQLPLLLPKFDEVYARSYCFSANYIYHLFVNGYKFTE ETWPQIHFEKEVGNSSIAWSLGYMLSLTNQIPAESPLIRLPIEPPHHHHH H
    • Predicted molecular weight

      51 kDa including tags
    • Amino acids

      44 to 485
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain (NP_001239).

Specifications

Our Abpromise guarantee covers the use of ab219293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • ATPDase
    • CD39 antigen like 3
    • CD39 antigen-like 3
    • CD39 like 3
    • CD39L3
    • Ecto apyrase
    • Ecto ATP diphosphohydrolase
    • Ecto-apyrase 3
    • Ecto-ATP diphosphohydrolase 3
    • Ecto-ATPase 3
    • Ecto-ATPDase 3
    • Ectonucleoside triphosphate diphosphohydrolase 3
    • ENTP3_HUMAN
    • ENTPD 3
    • ENTPD3
    • FLJ93839
    • HB 6
    • HB6
    • NTPDase 3
    • NTPDase3
    • OTTHUMP00000162079
    • OTTHUMP00000209227
    • OTTHUMP00000209228
    see all
  • Function

    Has a threefold preference for the hydrolysis of ATP over ADP.
  • Tissue specificity

    Expressed in adult brain, pancreas, spleen and prostate. Moderate or low expression is seen in most tissues. Not expressed in liver and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the GDA1/CD39 NTPase family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 μg ab219293.

    Molecular Weight: 50-70 kDa (SDS-PAGE under reducing conditions).

References

ab219293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up