Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MKKGIRYETSRKTSYIFQPQHGPWQTRMRKISNHGSLRVAKVAYPLGLCV GVFIYVAYIKWHRATATQAFFSITRAAPGARWGQQAHSPLGTAADGHEVF YGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKALKPGLSAYADDVEK SAQGIRELLDVAKQDIPFDFWKATPLVLKATAGLRLLPGEKAQKLLQKVK EVFKASPFLVGDDCVSIMNGTDEGVSAWITINFLTGSLKTPGGSSVGMLD LGGGSTQIAFLPRVEGTLQASPPGYLTALRMFNRTYKLYSYSYLGLGLMS ARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHAEVTYRVSGQKAAAS LHELCAARVSEVLQNRVHRTEEVKHVDFYAFSYYYDLAAGVGLIDAEKGG SLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVSLLLQEFGFPRSKVL KLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS
    • Amino acids

      1 to 483
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158060 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD39 antigen like 2
    • CD39 like 2
    • CD39L2
    • dJ738P15.3
    • DKFZp781G2277
    • DKFZp781K21102
    • Ectonucleoside triphosphate diphosphohydrolase 6
    • Ectonucleoside triphosphate diphosphohydrolase 6 (putative function)
    • ectonucleoside triphosphate diphosphohydrolase 6 (putative)
    • ENTPD 6
    • FLJ36711
    • HCV-E2 binding protein 1
    • IL 6SAG
    • IL6SAG
    • IL6ST2
    • Interleukin 6 signal transducer 2
    • NTPDase 6
    • NTPDase6
    see all
  • Relevance

    ENTPD6 (Ectonucleoside triphosphate diphosphohydrolase 6) is similar to divalent cation-dependent E-type nucleotidases (NTPases) which mediate catabolism of extracellular nucleotides. ENTPD6 may support glycosylation reactions in the Golgi apparatus and, when released from cells, may be involved in the hydrolysis of extracellular nucleotides. It preferentially hydrolyzes nucleoside 5'-diphosphates. Nucleoside 5'-triphosphates are hydrolyzed only to a minor extent and there is no hydrolysis of nucleoside 5'-monophosphates.
  • Cellular localization

    Golgi apparatus membrane; Single-pass type II membrane protein. Secreted. Note=But also occurs in a soluble extracellular form.

Images

  • ab158060 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158060 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158060.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up