Description

  • Product name

    Recombinant Human ENTPD6 protein (denatured)
    See all ENTPD6 proteins and peptides
  • Purity

    > 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSKWHRATATQAFFSITRAAPGARWGQQA HSPLGTAADGHEVFYGIMFDAGSTGTRVHVFQFTRPPRETPTLTHETFKA LKPGLSAYADDVEKSAQGIRELLDVAKQDIPFDFWKATPLVLKATAGLRL LPGEKAQKLLQKVKEVFKASPFLVGDDCVSIMNGTDEGVSAWITINFLTG SLKTPGGSSVGMLDLGGGSTQIAFLPRVEGTLQASPPGYLTALRMFNRTY KLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSPSFKGEWEHA EVTYRVSGQKAAASLHELCAARVSEVLQNRVHRTEEVKHVDFYAFSYYYD LAAGVGLIDAEKGGSLVVGDFEIAAKYVCRTLETQPQSSPFSCMDLTYVS LLLQEFGFPRSKVLKLTRKIDNVETSWALGAIFHYIDSLNRQKSPAS
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      61 to 484
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NCBI Accession No. NP_001238.
  • Description

    Recombinant Human ENTPD6 protein

Specifications

Our Abpromise guarantee covers the use of ab183226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names

    • CD39 antigen like 2
    • CD39 like 2
    • CD39L2
    • dJ738P15.3
    • DKFZp781G2277
    • DKFZp781K21102
    • Ectonucleoside triphosphate diphosphohydrolase 6
    • Ectonucleoside triphosphate diphosphohydrolase 6 (putative function)
    • ectonucleoside triphosphate diphosphohydrolase 6 (putative)
    • ENTPD 6
    • FLJ36711
    • HCV-E2 binding protein 1
    • IL 6SAG
    • IL6SAG
    • IL6ST2
    • Interleukin 6 signal transducer 2
    • NTPDase 6
    • NTPDase6
    see all
  • Relevance

    ENTPD6 (Ectonucleoside triphosphate diphosphohydrolase 6) is similar to divalent cation-dependent E-type nucleotidases (NTPases) which mediate catabolism of extracellular nucleotides. ENTPD6 may support glycosylation reactions in the Golgi apparatus and, when released from cells, may be involved in the hydrolysis of extracellular nucleotides. It preferentially hydrolyzes nucleoside 5'-diphosphates. Nucleoside 5'-triphosphates are hydrolyzed only to a minor extent and there is no hydrolysis of nucleoside 5'-monophosphates.
  • Cellular localization

    Golgi apparatus membrane; Single-pass type II membrane protein. Secreted. Note=But also occurs in a soluble extracellular form.

Images

  • 15% SDS-PAGE analysis of ab183226 (3μg).

References

ab183226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up