Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVPKLFTSQICLLLLLGLLAVEGSLHVKPPQFTWAQWFETQHINMTSQQC TNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHH SGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQY PVVPVHLDRII
    • Amino acids
      1 to 161
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ear4
    • EC=3.1.27.5
    • EDN
    • Eosinophil cationic type ribonuclease 4
    • MR 4
    • Non secretory ribonuclease
    • R14
    • R15
    • R5
    • Ribonuclease 2
    • Ribonuclease RNase A family 2 (liver eosinophil derived neurotoxin)
    • Ribonuclease US
    • RNase 2
    • RNase UpI 2
    • RNASE2
    • RNS2
    see all
  • Relevance
    Eosinophil derived neurotoxin (EDN) is a protein belonging to the ribonuclease (RNase) A superfamily. It has recently been found to have antiviral activity against respiratory syncytial virus and human immunodeficiency virus in vitro.
  • Cellular localization
    Lysosome (Probable). Cytoplasmic granule. Matrix of eosinophil's large specific granule.

Images

  • ab159356 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up