Description

  • Product name

    Recombinant human Eotaxin 2 protein
    See all Eotaxin 2 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. Determined by its ability to chemoattract human peripheral blood eosinophils using a concentration range of 50.0 -100.0 ng/mL.

  • Purity

    > 97 % SDS-PAGE.
    Purity is determined by SDS-PAGE and HPLC analyses.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGD PKQEWVQRYMKNLDAKQKKASPRARAVA
    • Predicted molecular weight

      9 kDa
    • Amino acids

      27 to 104
    • Additional sequence information

      The mature protein, which also includes a C-terminal truncation, contains 78 amino acid residues.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab202794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions. Reconstituted protein should be stored in working aliquots and stored at -20°C to -70°C. Avoid repeated freeze/thaw cycles.

General Info

  • Alternative names

    • C C motif chemokine 24
    • C-C motif chemokine 24
    • CCL24
    • CCL24_HUMAN
    • Chemokine CC Motif Ligand 24
    • CK beta 6
    • CK-beta-6
    • Ckb6
    • Eosinophil chemotactic protein 2
    • Eotaxin-2
    • MPIF 2
    • MPIF-2
    • MPIF2
    • Myeloid progenitor inhibitory factor 2
    • SCYA24
    • Small inducible cytokine A24
    • Small inducible cytokine subfamily A (Cys-Cys) member 24
    • Small-inducible cytokine A24
    see all
  • Function

    Chemotactic for resting T-lymphocytes, and eosinophils. Has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell line. Binds to CCR3.
  • Tissue specificity

    Activated monocytes and activated T lymphocytes.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab202794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up