Recombinant human Eotaxin protein (Active) (ab243753)
Key features and details
- Expression system: Escherichia coli
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, HPLC, SDS-PAGE
Description
-
Product name
Recombinant human Eotaxin protein (Active)
See all Eotaxin proteins and peptides -
Biological activity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration range of 0.1-10.0 ng/ml.
-
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDIC ADPKKKWVQDSMKYLDQKSPTPKP -
Predicted molecular weight
8 kDa -
Amino acids
24 to 97 -
Additional sequence information
Full-length mature chain lacking the signal peptide.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab243753 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
HPLC
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: PBS
0.2 µm filteredThis product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionWe recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at =-20 °C. Further dilutions should be made in appropriate buffered solutions.
General Info
-
Alternative names
- C-C motif chemokine 11
- CCL 11
- CCL11
see all -
Function
In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Post-translational
modificationsO-linked glycan consists of a Gal-GalNAc disaccharide which is mofified with up to 2 sialic acid residues. -
Cellular localization
Secreted. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (1)
ab243753 has been referenced in 1 publication.
- Wang R & Huang K CCL11 increases the proportion of CD4+CD25+Foxp3+ Treg cells and the production of IL-2 and TGF-ß by CD4+ T cells via the STAT5 signaling pathway. Mol Med Rep 21:2522-2532 (2020). PubMed: 32323817