For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-eotaxin-protein-active-ab243753.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Immunology Innate Immunity Chemokines Beta Chemokines (CC)
Share by email
Bioactive grade

Recombinant human Eotaxin protein (Active) (ab243753)

  • Datasheet
Submit a review Submit a question References (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human Eotaxin protein (Active) (ab243753)

    Key features and details

    • Expression system: Escherichia coli
    • Endotoxin level: < 1.000 Eu/µg
    • Active: Yes
    • Suitable for: Functional Studies, HPLC, SDS-PAGE

    Description

    • Product name

      Recombinant human Eotaxin protein (Active)
      See all Eotaxin proteins and peptides
    • Biological activity

      Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood eosinophils is in a concentration range of 0.1-10.0 ng/ml.

    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      Escherichia coli
    • Accession

      P51671
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDIC ADPKKKWVQDSMKYLDQKSPTPKP
      • Predicted molecular weight

        8 kDa
      • Amino acids

        24 to 97
      • Additional sequence information

        Full-length mature chain lacking the signal peptide.

    Associated products

    • Related Products

      • Anti-Eotaxin antibody [EPR5825] (ab133604)

    Specifications

    Our Abpromise guarantee covers the use of ab243753 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      Functional Studies

      HPLC

      SDS-PAGE

    • Form

      Lyophilized
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

      Constituent: PBS

      0.2 µm filtered

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at =-20 °C. Further dilutions should be made in appropriate buffered solutions.

    General Info

    • Alternative names

      • C-C motif chemokine 11
      • CCL 11
      • CCL11
      • CCL11_HUMAN
      • chemokine (C-C motif) ligand 11
      • Chemokine C C motif ligand 11
      • Chemokine CC Motif Ligand 11
      • Chemokine ligand 11
      • Eosinophil chemotactic protein
      • Eotaxin
      • eotaxin-1
      • MGC22554
      • SCYA 11
      • SCYA11
      • Small inducible cytokine A11
      • Small inducible cytokine subfamily A (Cys Cys) member 11
      • small inducible cytokine subfamily A (Cys-Cys), member 11 (eotaxin)
      • Small inducible cytokine subfamily A member 11
      • Small-inducible cytokine A11
      see all
    • Function

      In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.
    • Sequence similarities

      Belongs to the intercrine beta (chemokine CC) family.
    • Post-translational
      modifications

      O-linked glycan consists of a Gal-GalNAc disaccharide which is mofified with up to 2 sialic acid residues.
    • Cellular localization

      Secreted.
    • Target information above from: UniProt accession P51671 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant human Eotaxin protein (Active) (ab243753)
      SDS-PAGE - Recombinant human Eotaxin protein (Active) (ab243753)
      SDS-PAGE analysis of ab243753

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (1)

    Publishing research using ab243753? Please let us know so that we can cite the reference in this datasheet.

    ab243753 has been referenced in 1 publication.

    • Wang R & Huang K CCL11 increases the proportion of CD4+CD25+Foxp3+ Treg cells and the production of IL-2 and TGF-ß by CD4+ T cells via the STAT5 signaling pathway. Mol Med Rep 21:2522-2532 (2020). PubMed: 32323817

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab243753.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.