Description

  • Product name

    Recombinant Human Eotaxin protein (Animal Free)
    See all Eotaxin proteins and peptides
  • Purity

    >= 98 % SDS-PAGE.
    Greater than 98% by SDS-PAGE gel and HPLC analyses.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDIC ADPKKKWVQDSMKYLDQKSPTPKP
    • Predicted molecular weight

      8 kDa
    • Amino acids

      24 to 97
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab242437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituent: 0.1% Trifluoroacetic acid

    Sterile filtered through a 0.2 micron filter

  • Reconstitution
    Centrifuge vial prior to opening. Reconstitute in water to 0.1-1.0 mg/ml. Do not vortex. Store at 2°C to 8°C for 1 week, or prepare for extended storage.

General Info

  • Alternative names

    • C-C motif chemokine 11
    • CCL 11
    • CCL11
    • CCL11_HUMAN
    • chemokine (C-C motif) ligand 11
    • Chemokine C C motif ligand 11
    • Chemokine CC Motif Ligand 11
    • Chemokine ligand 11
    • Eosinophil chemotactic protein
    • Eotaxin
    • eotaxin-1
    • MGC22554
    • SCYA 11
    • SCYA11
    • Small inducible cytokine A11
    • Small inducible cytokine subfamily A (Cys Cys) member 11
    • small inducible cytokine subfamily A (Cys-Cys), member 11 (eotaxin)
    • Small inducible cytokine subfamily A member 11
    • Small-inducible cytokine A11
    see all
  • Function

    In response to the presence of allergens, this protein directly promotes the accumulation of eosinophils, a prominent feature of allergic inflammatory reactions. Binds to CCR3.
  • Sequence similarities

    Belongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications

    O-linked glycan consists of a Gal-GalNAc disaccharide which is mofified with up to 2 sialic acid residues.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab242437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab242437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up