Overview

  • Product name

    Recombinant Human Epac2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MVAAHAAHSSSSAEWIACLDKRPLERSSEDVDIIFTRLKEVKAFEKFHPN LLHQICLCGYYENLEKGITLFRQGDIGTNWYAVLAGSLDVKVSETSSHQD AVTICTLGIGTAFGESILDNTPRHATIVTRESSELLRIEQKDFKALWEKY RQYMAGLLAPPYGVMETGSNNDRIPDKENTPLIEPHVPLRPANTITKVPS EKILRAGKILRNAILSRAPHMIRDRKYHLKTYRQCCVGTELVDWMMQQTP CVHSRTQAVGMWQVLLEDGVLNHVDQEHHFQDKYLFYRFLDDEHEDAPLP TEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEE LLHIKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKG SVNVVIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDK EDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTV MSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLCPAL VAHYHAQPSQGTEQEKMDYALNNKRRVIRLVLQWAAMYGDLLQEDDVSMA FLEEFYVSVSDDARMIAALKEQLPELEKIVKQISEDAKAPQKKHKVLLQQ FNTGDERAQKRQPIRGSDEVLFKVYCMDPTYTTIRVPVATSVKEVISAVA DKLGSGEGLIIVKMSSGGEKVVLKPNDVSVFMTLTINGRLFACPREQFDS LTPLPEQEGPTVGTVGTFELMSSKDLAYQMTIYDWELFNCVHELELIYHT FGRHNFKKTTANLDLFLRRFNEIQFWVVTEICLCSQLSKRVQLLKKFIKI AAHCKEYKNLNSFFAIVMGLSNVAVSRLALTWEKLPSKFKKFYAEFESLM DPSRNHRAYRLTVAKLEPPLIPFMPLLIKDMTFTHEGNKTFIDNLVNFEK MRMIANTARTVRYYRSQPFNPDAAQANKNHQDVRSYVRQLNVIDNQRTLS QMSHRLEPRRP
    • Amino acids

      1 to 1011
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAMP GEFII
    • cAMP regulated guanine nucleotide exchange factor II
    • cAMP-GEFII
    • cAMP-regulated guanine nucleotide exchange factor II
    • CAMPGEFII
    • CGEF 2
    • CGEF2
    • Epac 2
    • EPAC2
    • Exchange factor directly activated by cAMP 2
    • Exchange protein directly activated by cAMP 2
    • Nbla00496
    • Putative protein product of Nbla00496
    • Rap guanine nucleotide exchange factor (GEF) 4
    • Rap guanine nucleotide exchange factor 4
    • RAPGEF 4
    • Rapgef4
    • RPGF4_HUMAN
    see all
  • Function

    Guanine nucleotide exchange factor (GEF) for RAP1A, RAP1B and RAP2A small GTPases that is activated by binding cAMP. Seems not to activate RAB3A. Involved in cAMP-dependent, PKA-independent exocytosis through interaction with RIMS2.
  • Tissue specificity

    Predominantly expressed in brain and adrenal gland. Isoform 2 is expressed in liver. Isoform 1 is expressed in liver at very low levels.
  • Sequence similarities

    Contains 2 cyclic nucleotide-binding domains.
    Contains 1 DEP domain.
    Contains 1 N-terminal Ras-GEF domain.
    Contains 1 Ras-GEF domain.
  • Domain

    The N-terminal nucleotide phosphate binding region cAMP 1 has a much lower affinity for cAMP as compared to cAMP 2.
    The DEP domain is involved in membrane localization independent from regulation by cAMP.
  • Cellular localization

    Cytoplasm. Membrane.
  • Information by UniProt

Images

  • ab153155 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up