Description

  • Product name

    Recombinant Human EPCR/CD201 protein
    See all EPCR/CD201 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTI IQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLG CELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFTLQQ LNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRSYTSVDHHHHH H
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      18 to 210
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151362 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • Activated protein C receptor
    • APC receptor
    • APCR
    • bA42O4.2
    • CCCA
    • CCD41
    • CD201
    • CD201 antigen
    • cell cycle, centrosome-associated protein
    • Cell cycle, centrosome-associated protein
    • centrocyclin
    • Endothelial cell protein C receptor
    • Endothelial protein C receptor
    • EPCR
    • EPCR_HUMAN
    • MGC23024
    • PROCR
    • Protein C receptor, endothelial
    see all
  • Function

    Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation.
  • Tissue specificity

    Expressed strongly in the endothelial cells of arteries and veins in heart and lung, less intensely in capillaries in the lung and skin, and not at all in the endothelium of small vessels of the liver and kidney.
  • Post-translational
    modifications

    N-glycosylated.
    A soluble form exists; probably released by a metalloprotease. Seems to have the same activity as the membrane-bound form.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab151362 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151362.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up