Recombinant Human EPCR/CD201 protein (Fc Chimera His Tag) (ab222997)

Description

  • Product name

    Recombinant Human EPCR/CD201 protein (Fc Chimera His Tag)
    See all EPCR/CD201 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTN TTIIQLQPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRC FLGCELPPEGSRAHVFFEVAVNGSSFVSFRPERALWQADTQVTSGVVTFT LQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRSYTSLEPK SCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCL VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      18 to 211
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hlgG-His-tag at C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab222997 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Activated protein C receptor
    • APC receptor
    • APCR
    • bA42O4.2
    • CCCA
    • CCD41
    • CD201
    • CD201 antigen
    • cell cycle, centrosome-associated protein
    • Cell cycle, centrosome-associated protein
    • centrocyclin
    • Endothelial cell protein C receptor
    • Endothelial protein C receptor
    • EPCR
    • EPCR_HUMAN
    • MGC23024
    • PROCR
    • Protein C receptor, endothelial
    see all
  • Function

    Binds activated protein C. Enhances protein C activation by the thrombin-thrombomodulin complex; plays a role in the protein C pathway controlling blood coagulation.
  • Tissue specificity

    Expressed strongly in the endothelial cells of arteries and veins in heart and lung, less intensely in capillaries in the lung and skin, and not at all in the endothelium of small vessels of the liver and kidney.
  • Post-translational
    modifications

    N-glycosylated.
    A soluble form exists; probably released by a metalloprotease. Seems to have the same activity as the membrane-bound form.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 3 μg of ab222997 was analysed by 15% SDS-PAGE.

References

ab222997 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222997.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up