Description

  • Product name

    Recombinant human Eph receptor A1/EphA1 protein
    See all Eph receptor A1/EphA1 proteins and peptides
  • Biological activity

    The specific activity of ab206006 was determined to be 20 nmol/min/mg.

  • Purity

    > 95 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LDFTRELDPAWLMVDTVIGEGEFGEVYRGTLRLPSQDCKTVAIKTLKDTS PGGQWWNFLREATIMGQFSHPHILHLEGVVTKRKPIMIITEFMENGALDA FLREREDQLVPGQLVAMLQGIASGMNYLSNHNYVHRDLAARNILVNQNLC CKVSDFGLTRLLDDFDGTYETQGGKIPIRWTAPEAIAHRIFTTASDVWSF GIVMWEVLSFGDKPYGEMSNQEVMKSIEDGYRLPPPVDCPAPLYELMKNC WAYDRARRPHFQKLQAHLEQLLANPHSLRT
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      613 to 892
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_005232

Specifications

Our Abpromise guarantee covers the use of ab206006 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Previously labelled as Eph receptor A1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • EPH
    • EPH receptor A1
    • EPH tyrosine kinase
    • EPH tyrosine kinase 1
    • Epha1
    • EPHA1_HUMAN
    • Ephrin receptor Eph A1
    • Ephrin type A receptor 1
    • Ephrin type-A receptor 1
    • EPHT
    • EPHT 1
    • EPHT1
    • Erythropoietin producing hepatoma amplified sequence
    • Erythropoietin-producing hepatoma receptor
    • Esk
    • hEpha1
    • MGC163163
    • Oncogene EPH
    • Soluble EPHA1 variant 1
    • Soluble EPHA1 variant 2
    • Tyrosine protein kinase receptor EPH
    • Tyrosine-protein kinase receptor EPH
    see all
  • Function

    Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Binds with a low affinity EFNA3 and EFNA4 and with a high affinity to EFNA1 which most probably constitutes its cognate/functional ligand. Upon activation by EFNA1 induces cell attachment to the extracellular matrix inhibiting cell spreading and motility through regulation of ILK and downstream RHOA and RAC. Plays also a role in angiogenesis and regulates cell proliferation. May play a role in apoptosis.
  • Tissue specificity

    Overexpressed in several carcinomas.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 1 Eph LBD (Eph ligand-binding) domain.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications

    Phosphorylated. Autophosphorylation is stimulated by its ligand EFNA1.
    Ubiquitinated.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab206006 by densitometry, approximate MW 55 kDa.

  • The specific activity of ab206006 was determined to be 20 nmol/min/mg.

References

ab206006 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206006.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up