Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAGIFYFALFSCLFGICDAVTGSRVYPANEVTLLDSRSVQGELGWIASPL EGGWEEVSIMDEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIE IKFTLRDCNSLPGVMGTCKETFNLYYYESDNDKERFIRENQFVKIDTIAA DESFTQVDIGDRIMKLNTEIRDVGPLSKKGFYLAFQDVGACIALVSVRVF YKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEKDVPKMYCGAD GEWLVPIGNCLCNAGHEERSGECQACKIGYYKALSTDATCAKCPPHSYSV WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSS PQNTGGRQDISYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKTTKVSI TDLLAHTNYTFEIWAVNGVSKYNPNPDQSVSVTVTTNQAAPSSIALVQAK EVTRYSVALAWLEPDRPNGVILEYEVKYYEKDQNERSYRIVRTAARNTDI KGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLL VSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICV AIKTLKAGYTDKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITE YMENGSLDAFLRKNDGRFTVIQLVGMLRGIGSGMKYLSDMSYVHRDLAAR NILVNSNLVCKVSDFGMSRVLEDDPEAAYTTRGGKIPIRWTAPEAIAYRK FTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPPPMDCP IALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHVNQED LARIGITAITHQNKILSSVQAMRTQMQQMHGRMVPV
    • Molecular weight

      136 kDa including tags
    • Amino acids

      1 to 986
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 ug/ul.

     This product was previously labelled as Eph receptor A4

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cek 8
    • CEK8
    • EK8
    • eph receptor a4
    • EPH-like kinase 8
    • EPHA4
    • EPHA4_HUMAN
    • Ephrin type-A receptor 4
    • HEK 8
    • hEK8
    • Receptor protein-tyrosine kinase HEK8
    • SEK
    • Sek 1
    • TYRO 1 protein tyrosine kinase
    • TYRO1
    • Tyrosine-protein kinase receptor SEK
    • Tyrosine-protein kinase TYRO1
    see all
  • Function

    Receptor for members of the ephrin-A family. Binds to ephrin-A1, -A4 and -A5. Binds more poorly to ephrin-A2 and -A3. May play a role in a signal transduction process involved in hindbrain pattern formation.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Domain

    The protein kinase domain mediates interaction with NGEF/ephexin-1.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132958 stained with Coomassie Blue.

References

ab132958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up