Recombinant Human Eph receptor B1 / NET protein (ab158374)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKAC PAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACT
    • Amino acids
      221 to 320
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158374 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Product previously known as Recombinant Human Eph receptor B1 protein.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cek 6
    • EK6
    • ELK
    • Elkh
    • EPH receptor B1
    • Eph tyrosine kinase 2
    • EPH-like kinase 6
    • Ephb1
    • EPHB1_HUMAN
    • Ephrin type B receptor 1
    • Ephrin type-B receptor 1
    • EPHT2
    • HEK 6
    • HEK6
    • NET
    • Neuronally-expressed EPH-related tyrosine kinase
    • soluble EPHB1 variant 1
    • Tyrosine protein kinase receptor EPH 2
    • Tyrosine-protein kinase receptor EPH-2
    see all
  • Function
    Receptor for members of the ephrin-B family. Binds to ephrin-B1, -B2 and -B3. Binding with the guidance cue ephrin-B2 at the optic chiasm midline redirect ventrotemporal (VT) retinal ganglion cells (RGCs) axons ipsilaterally. May be involved in cell-cell interactions in the nervous system.
  • Tissue specificity
    Preferentially expressed in brain.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158374 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158374 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158374.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up