Recombinant Human Eph receptor B1/NET protein (Fc Chimera) (ab185828)

Description

  • Product name

    Recombinant Human Eph receptor B1/NET protein (Fc Chimera)
    See all Eph receptor B1/NET proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVFEPN QNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYET DSVIATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGP LTRNGFYLAFQDYGACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTS LVIARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVAC KACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEV ACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIICKKCRADR RSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSP FPPQHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDY EIRYYEKEHNEFNSSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKF SGKMCFQTLTDDDYKSELRE QLPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVV SVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Predicted molecular weight

      86 kDa including tags
    • Amino acids

      18 to 540
    • Additional sequence information

      Extracellular domain with a FC tag at the C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab185828 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

    Product previously known as Recombinant Human Eph receptor B1 protein (Fc Chimera)

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Reconstitute for long term storage.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µM filtered solution

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. After reconstitution aliquot and store at < -20 degrees, avoid freeze/thaw cycles.

General Info

  • Alternative names

    • Cek 6
    • EK6
    • ELK
    • Elkh
    • EPH receptor B1
    • Eph tyrosine kinase 2
    • EPH-like kinase 6
    • Ephb1
    • EPHB1_HUMAN
    • Ephrin type B receptor 1
    • Ephrin type-B receptor 1
    • EPHT2
    • HEK 6
    • HEK6
    • NET
    • Neuronally-expressed EPH-related tyrosine kinase
    • soluble EPHB1 variant 1
    • Tyrosine protein kinase receptor EPH 2
    • Tyrosine-protein kinase receptor EPH-2
    see all
  • Function

    Receptor for members of the ephrin-B family. Binds to ephrin-B1, -B2 and -B3. Binding with the guidance cue ephrin-B2 at the optic chiasm midline redirect ventrotemporal (VT) retinal ganglion cells (RGCs) axons ipsilaterally. May be involved in cell-cell interactions in the nervous system.
  • Tissue specificity

    Preferentially expressed in brain.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab185828 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185828.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up