Description

  • Product name

    Recombinant human Eph receptor B2 protein
    See all Eph receptor B2 proteins and peptides
  • Biological activity

    The specific activity of ab205990 was determined to be 220 nmol/min/mg.

  • Purity

    > 95 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      REFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGY TEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDS FLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLV CKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDV WSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLM LDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKA
    • Predicted molecular weight

      56 kDa including tags
    • Amino acids

      611 to 893
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_004442

Specifications

Our Abpromise guarantee covers the use of ab205990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • cek5
    • Developmentally regulated EPH related tyrosine kinase
    • DRT
    • EK5
    • ELK related protein tyrosine kinase
    • Eph receptor B2
    • EPH tyrosine kinase 3
    • EPH-like kinase 5
    • EPHB2
    • EPHB2_HUMAN
    • Ephrin type B receptor 2
    • Ephrin type-B receptor 2
    • EPHT 3
    • ERK
    • ETECK
    • hEK5
    • Nuk
    • Prkm 5
    • Receptor protein tyrosine kinase HEK 5
    • Renal carcinoma antigen NY-REN-47
    • Sek 3
    • Tyro 5
    • Tyrosine protein kinase receptor CEK 5
    • Tyrosine protein kinase receptor EPH 3
    • Tyrosine protein kinase receptor QEK 5
    • Tyrosine-protein kinase receptor EPH-3
    • Tyrosine-protein kinase TYRO5
    see all
  • Function

    Receptor for members of the ephrin-B family. Phosphorylates ARHGEF15, leading to its ubiquitination and degradation by the proteasome which promotes EFNB1-dependent synapse formation. Can function in aspects of retinal ganglion cell axon guidance to the optic disk even when lacking its tyrosine kinase domain. Acts as a tumor suppressor.
  • Tissue specificity

    Brain, heart, lung, kidney, placenta, pancreas, liver and skeletal muscle. Preferentially expressed in fetal brain.
  • Involvement in disease

    Defects in EPHB2 may be a cause of susceptibility to prostate cancer (PC) [MIM:176807]. It is a malignancy originating in tissues of the prostate. Most prostate cancers are adenocarcinomas that develop in the acini of the prostatic ducts. Other rare histopathologic types of prostate cancer that occur in approximately 5% of patients include small cell carcinoma, mucinous carcinoma, prostatic ductal carcinoma, transitional cell carcinoma, squamous cell carcinoma, basal cell carcinoma, adenoid cystic carcinoma (basaloid), signet-ring cell carcinoma and neuroendocrine carcinoma. Note=EPHB2 mutations have been found in a prostate cancer cell line derived from a brain metastasis.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab205990.

  • Sample Kinase Activity Plot. The specific activity of ab205990 was determined to be 220 nmol/min/mg.

References

ab205990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205990.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up