Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCREDGQWAE QPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTI GSAVCQCRVGYFRARTDPRGAPCTTP
    • Amino acids
      198 to 323
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158377 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Ephb4
    • EPHB4_HUMAN
    • Ephrin receptor EphB4
    • Ephrin type-B receptor 4
    • Hepatoma Transmembrane Kinase
    • HTK
    • MYK 1
    • MYK1
    • TYRO 11
    • TYRO11
    • Tyrosine-protein kinase receptor HTK
    • Tyrosine-protein kinase TYRO11
    see all
  • Function
    Receptor for members of the ephrin-B family. Binds to ephrin-B2. May have a role in events mediating differentiation and development.
  • Tissue specificity
    Abundantly expressed in placenta and in a range of primary tissues and malignant cell lines. Expressed in fetal, but not adult, brain, and in primitive and myeloid, but not lymphoid, hematopoietic cells.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 protein kinase domain.
    Contains 1 SAM (sterile alpha motif) domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab158377 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158377 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158377.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up