Description

  • Product name

    Recombinant Human Ephexin-1 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQERG WFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
    • Amino acids

      612 to 710
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ARHGEF27
    • Eph receptor-interacting exchange protein
    • Eph-interacting exchange protein
    • EPHEXIN
    • Ephexin-1
    • Guanine nucleotide exchange factor, neuronal
    • Neuronal guanine nucleotide exchange factor
    • Ngef
    • NGEF_HUMAN
    see all
  • Function

    Acts as a guanine nucleotide exchange factor (GEF) which differentially activates the GTPases RHOA, RAC1 and CDC42. Plays a role in axon guidance regulating ephrin-induced growth cone collapse. Upon activation by ephrin through EPHA4, the GEF activity switches toward RHOA resulting in its activation. Activated RHOA promotes cone retraction at the expense of RAC1-and CDC42-stimulated growth cone extension.
  • Tissue specificity

    Highly expressed in brain specifically in caudate nucleus and to a lower extent in amygdala and hippocampus. Also detected in lung.
  • Sequence similarities

    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Domain

    The DH domain and the PH domain are both required to mediate interaction with EPHA4.
  • Post-translational
    modifications

    Src-dependent phosphorylation at Tyr-179 upon EPHA4 activation increases the guanine exchange factor activity toward RHOA.
  • Cellular localization

    Cytoplasm. Membrane. Cell projection > growth cone. Associated with membranes. Localizes to axonal growth cones.
  • Information by UniProt

Images

  • ab161782 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161782 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161782.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up