Overview

  • Product name

    Recombinant Human Ephrin A2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHA GAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHA SCDHRQRGFKRWECNRPAAPGGPLKFSEKFQLFTPFSLGFEFRPGHEYYY ISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLF LSTIPVLWTLLGS
    • Molecular weight

      50 kDa including tags
    • Amino acids

      1 to 213

Specifications

Our Abpromise guarantee covers the use of ab114898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EFNA 2
    • efna2
    • EFNA2_HUMAN
    • ELF1
    • Eph related receptor tyrosine kinase ligand 6
    • EPH-related receptor tyrosine kinase ligand 6
    • Ephrin-A2
    • EphrinA2
    • EPLG6
    • HEK7 L
    • HEK7 ligand
    • HEK7-L
    • HEK7L
    • LERK 6
    • LERK-6
    • LERK6
    • Ligand of eph related kinase 6
    see all
  • Sequence similarities

    Belongs to the ephrin family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114898 at approximately 50.43kDa.
    Stained with Coomassie Blue.

References

ab114898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for contacting us.

I can confirm that this protein does contain Tris HCL which is harmful for living cells so this product may not be suitable for functional assays.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Free Rabbit monoclonal antibody with any purchase of a primary antibody, while stocks last! Quote “RABMAB-XBSMG” in your next primary antibody order. For more information, visit the following link: https://www.abcam.com/index.html?pageconfig=resource&rid=15447

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up