Description

  • Product name

    Recombinant Human Ephrin A3 protein
    See all Ephrin A3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVG PGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKF SEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSH SGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSIS
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      23 to 213
    • Additional sequence information

      This product is the mature full length protein from aa 23 to 213. The signal peptide and propeptide are not included. Fused with Human IgG1 Fc tag at the C terminal (AAI10407).

Specifications

Our Abpromise guarantee covers the use of ab201415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.50
    Constituents: 0.75% Glycine, 5% Trehalose, 0.61% Tris, L-Arginine, Sodium chloride

    Lyophilised from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilised product in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • EFL 2
    • EFL-2
    • EFL2
    • EFN A3
    • EFNA 3
    • Efna3
    • EFNA3_HUMAN
    • EHK1 L
    • EHK1 ligand
    • EHK1-L
    • EHK1L
    • EPH related receptor tyrosine kinase ligand 3
    • EPH-related receptor tyrosine kinase ligand 3
    • Ephrin-A3
    • EphrinA3
    • EPLG 3
    • EPLG3
    • LERK 3
    • LERK-3
    • LERK3
    • Ligand of eph related kinase 3
    see all
  • Tissue specificity

    Expressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the ephrin family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab201415 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 60-65 kDa in SDS-PAGE due to glycosylation.

References

ab201415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up