Description

  • Product name

    Recombinant Human Ephrin A4 protein (Fc Chimera)
    See all Ephrin A4 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFAL YMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFL PGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      26 to 171
    • Additional sequence information

      This protein carries a human IgG1 Fc tag at the C terminus. This product is for the mature full length protein. The signal peptide and propeptide are not included. (Accession # AAI07484).

Specifications

Our Abpromise guarantee covers the use of ab219713 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris buffer, 0.75% Glycine, L-Arginine, Sodium chloride

    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • EFL 4
    • EFL4
    • EFN A4
    • EFNA 4
    • EFNA4
    • EFNA4_HUMAN
    • Eph related receptor tyrosine kinase ligand 4
    • EPH-related receptor tyrosine kinase ligand 4
    • Ephrin-A4
    • EphrinA4
    • EPLG 4
    • EPLG4
    • LERK 4
    • LERK-4
    • LERK4
    • Ligand of Eph related kinase 4
    • MGC125826
    see all
  • Function

    May play a role in the interaction between activated B lymphocytes and dendritic cells in tonsils.
  • Tissue specificity

    Expressed in the adult spleen, lymph node, prostate, ovary, small intestine, and colon, and in fetal heart, lung, liver and kidney. Also detected in hematopoietic cell lines.
  • Sequence similarities

    Belongs to the ephrin family.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab219713 stained overnight with Coomassie Blue.

References

ab219713 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219713.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up