Description

  • Product name

    Recombinant human Ephrin B1 protein
    See all Ephrin B1 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.

    Immobilised ab181909 at 10 µg/ml can bind Human EPHB6 with a linear range of 0.2-8 µg/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYK LYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFK KHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLT TSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSS GDPDG
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      28 to 232
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_004420

Specifications

Our Abpromise guarantee covers the use of ab181909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in 200 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CFND
    • CFNS
    • Craniofrontonasal syndrome (craniofrontonasal dysplasia)
    • EFL 3
    • EFL-3
    • EFL3
    • EFNB1
    • EFNB1_HUMAN
    • Elk L
    • ELK ligand
    • ELK-L
    • Eph related receptor tyrosine kinase ligand 2
    • EPH-related receptor tyrosine kinase ligand 2
    • Ephrin-B1
    • EPLG2
    • LERK 2
    • LERK-2
    • LERK2
    • Ligand of eph related kinase 2
    • MGC8782
    see all
  • Function

    Binds to the receptor tyrosine kinases EPHB1 and EPHA1. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
  • Tissue specificity

    Heart, placenta, lung, liver, skeletal muscle, kidney, pancreas.
  • Involvement in disease

    Defects in EFNB1 are a cause of craniofrontonasal syndrome (CFNS) [MIM:304110]; also known as craniofrontonasal dysplasia (CFND). CFNS is an X-linked inherited syndrome characterized by hypertelorism, coronal synostosis with brachycephaly, downslanting palpebral fissures, clefting of the nasal tip, joint anomalies, longitudinally grooved fingernails and other digital anomalies.
  • Sequence similarities

    Belongs to the ephrin family.
  • Post-translational
    modifications

    Inducible phosphorylation of tyrosine residues in the cytoplasmic domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab181909 stained overnight with Coomassie Blue. 

    DTT-reduced protein migrates as 32-40 kDa due to glycosylation.

References

ab181909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up