Description

  • Product name

    Recombinant Human Ephrin B1 protein (Fc Chimera His Tag)
    See all Ephrin B1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYE YYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGL EFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPE QLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASG GSSGDPDGFFNSKLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHH HH
    • Predicted molecular weight

      50 kDa including tags
    • Amino acids

      28 to 237
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Fused to hIgG-His-tag at C- terminus. NP_004420. Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab235877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • CFND
    • CFNS
    • Craniofrontonasal syndrome (craniofrontonasal dysplasia)
    • EFL 3
    • EFL-3
    • EFL3
    • EFNB1
    • EFNB1_HUMAN
    • Elk L
    • ELK ligand
    • ELK-L
    • Eph related receptor tyrosine kinase ligand 2
    • EPH-related receptor tyrosine kinase ligand 2
    • Ephrin-B1
    • EPLG2
    • LERK 2
    • LERK-2
    • LERK2
    • Ligand of eph related kinase 2
    • MGC8782
    see all
  • Function

    Binds to the receptor tyrosine kinases EPHB1 and EPHA1. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
  • Tissue specificity

    Heart, placenta, lung, liver, skeletal muscle, kidney, pancreas.
  • Involvement in disease

    Defects in EFNB1 are a cause of craniofrontonasal syndrome (CFNS) [MIM:304110]; also known as craniofrontonasal dysplasia (CFND). CFNS is an X-linked inherited syndrome characterized by hypertelorism, coronal synostosis with brachycephaly, downslanting palpebral fissures, clefting of the nasal tip, joint anomalies, longitudinally grooved fingernails and other digital anomalies.
  • Sequence similarities

    Belongs to the ephrin family.
  • Post-translational
    modifications

    Inducible phosphorylation of tyrosine residues in the cytoplasmic domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PADE analysis of 3 µg ab235877.

    50-70 kDa (Under reducing conditions)

References

ab235877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up