Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYK VYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQ KNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNK DPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVAL FAVDHHHHHH
    • Molecular weight

      23 kDa including tags
    • Amino acids

      28 to 229
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 0.100 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    ab151892 is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • EFN B2
    • EFNB 2
    • Efnb2
    • EFNB2_HUMAN
    • Eph related receptor tyrosine kinase ligand 5
    • EPH-related receptor tyrosine kinase ligand 5
    • ephrin B2
    • Ephrin-B2
    • EphrinB2
    • EPLG 5
    • EPLG5
    • Htk L
    • HTK ligand
    • HTK-L
    • HTKL
    • LERK 5
    • LERK-5
    • LERK5
    • Ligand of eph related kinase 5
    • MGC126226
    • MGC126227
    • MGC126228
    • OTTMUSP00000024973
    see all
  • Function

    Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Binds to receptor tyrosine kinase including EPHA4, EPHA3 and EPHB4. Together with EPHB4 plays a central role in heart morphogenesis and angiogenesis through regulation of cell adhesion and cell migration. EPHB4-mediated forward signaling controls cellular repulsion and segregation from EFNB2-expressing cells. May play a role in constraining the orientation of longitudinally projecting axons.
    (Microbial infection) Acts as a receptor for Hendra virus and Nipah virus.
  • Tissue specificity

    Lung and kidney.
  • Sequence similarities

    Belongs to the ephrin family.
    Contains 1 ephrin RBD (ephrin receptor-binding) domain.
  • Post-translational
    modifications

    Inducible phosphorylation of tyrosine residues in the cytoplasmic domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab151892 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up