Description

  • Product name

    Recombinant Human Ephrin B3 protein (His tag)
    See all Ephrin B3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSP NYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNL WGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGG AVPRKPVSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPS MPHHHHHH
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      28 to 226
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain of Ephrin B3.

Specifications

Our Abpromise guarantee covers the use of ab219452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, 90% PBS

General Info

  • Alternative names

    • EFL 6
    • EFL6
    • EFNB 3
    • Efnb3
    • EFNB3_HUMAN
    • EPH related receptor transmembrane ligand ELK L3
    • EPH related receptor transmembrane ligand ELKL3
    • EPH related receptor tyrosine kinase ligand 8
    • EPH-related receptor transmembrane ligand ELK-L3
    • EPH-related receptor tyrosine kinase ligand 8
    • Ephrin B3
    • Ephrin-B3
    • EphrinB3
    • EPLG 8
    • EPLG8
    • LERK 8
    • LERK-8
    • LERK8
    see all
  • Function

    May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.
  • Tissue specificity

    Highly expressed in brain; expressed in embryonic floor plate, roof plate and hindbrain segments.
  • Sequence similarities

    Belongs to the ephrin family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE using 3ug of ab219452.

References

ab219452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up