Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTLRAAVFDLDGVLALPAVFGVLGRTEEALALPRGLLNDAFQKGGPEGAT TRLMKGEITLSQWIPLMEENCRKCSETAKVCLPKNFSIKEIFDKAISARK INRPMLQAALMLRKKGFTTAILTNTWLDDRAERDGLAQLMCELKMHFDFL IESCQVGMVKPEPQIYKFLLDTLKASPSEVVFLDDIGANLKPARDLGMVT ILVQDTDTALKELEKVTGIQLLNTPAPLPTSCNPSDMSHGYVTVKPRVRL HFVELGSGPAVCLCHGFPESWYSWRYQIPALAQAGYRVLAMDMKGYGESS APPEIEEYCMEVLCKEMVTFLDKLGLSQAVFIGHDWGGMLVWYMALFYPE RVRAVASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQN LSRTFKSLFRASDESVLSMHKVCEAGGLFVNSPEEPSLSRMVTEEEIQFY VQQFKKSGFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLV PQMSQHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLDSDARNPP VVSKM
    • Amino acids
      1 to 555
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158378 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bifunctional epoxide hydrolase 2
    • CEH
    • Cytosolic epoxide hydrolase
    • EPHX2
    • Epoxide hydratase
    • Epoxide hydrolase 2
    • Epoxide hydrolase 2 cytoplasmic
    • epoxide hydrolase 2, cytosolic
    • Epoxide hydrolase soluble
    • HYES_HUMAN
    • SEH
    • Soluble epoxide hydrolase
    see all
  • Function
    Acts on epoxides (alkene oxides, oxiranes) and arene oxides. Plays a role in xenobiotic metabolism by degrading potentially toxic epoxides. Also determines steady-state levels of physiological mediators. Has low phosphatase activity.
  • Sequence similarities
    Belongs to the AB hydrolase superfamily. Epoxide hydrolase family.
  • Domain
    The N-terminal domain has phosphatase activity. The C-terminal domain has epoxide hydrolase activity.
  • Post-translational
    modifications
    The N-terminus is blocked.
    The covalent modification of cysteine by 15-deoxy-Delta12,14-prostaglandin-J2 is autocatalytic and reversible. It may occur as an alternative to other cysteine modifications, such as S-nitrosylation and S-palmitoylation.
  • Cellular localization
    Cytoplasm. Peroxisome.
  • Information by UniProt

Images

  • ab158378 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158378 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158378.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up