Overview

  • Product name

    Recombinant Human EPLIN protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MENCLGESRHEVEKSEISENTDASGKIEKYNVPLNRLKMMFEKGEPTQTK ILRAQSRSASGRKISENSYSLDDLEIGPGQLSSSTFDSEKNESRRNLELP RLSETSIKDRMAKYQAAVSKQSSSTNYTNELKASGGEIKIHKMEQKENVP PGPEVCITHQEGEKISANENSLAVRSTPAEDDSRDSQVKSEVQQPVHPKP LSPDSRASSLSESSPPKAMKFQAPARETCVECQKTVYPMERLLANQQVFH ISCFRCSYCNNKLSLGTYASLHGRIYCKPHFNQLFKSKGNYDEGFGHRPH KDLWASKNENEEILERPAQLANARETPHSPGVEDAPIAKVGVLAASMEAK ASSQQEKEDKPAETKKLRIAWPPPTELGSSGSALEEGIKMSKPKWPPEDE ISKPEVPEDVDLDLKKLRRSSSLKERSRPFTVAASFQSTSVKSPKTVSPP IRKGWSMSEQSEESVGGRVAERKQVENAKASKKNGNVGKTTWQNKESKGE TGKRSKEGHSLEMENENLVENGADSDEDDNSFLKQQSPQEPKSLNWSSFV DNTFAEEFTTQNQKSQDVELWEGEVVKELSVEEQIKRNRYYDEDEDEE
    • Molecular weight

      92 kDa including tags
    • Amino acids

      161 to 759

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132150 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced.

General Info

  • Alternative names

    • 1110021C24Rik
    • Epithelial protein lost in neoplasm
    • Epithelial protein lost in neoplasm beta
    • EPLIN
    • FLJ38853
    • LIM domain and actin binding 1
    • LIM domain and actin binding protein 1
    • LIM domain and actin-binding protein 1
    • LIMA1
    • LIMA1_HUMAN
    • MGC131726
    • SREBP3
    • Sterol regulatory element binding protein 3
    see all
  • Function

    Binds to actin monomers and filaments. Increases the number and size of actin stress fibers and inhibits membrane ruffling. Inhibits actin filament depolymerization. Bundles actin filaments, delays filament nucleation and reduces formation of branched filaments.
  • Tissue specificity

    Highly expressed in placenta, kidney, pancreas, prostate, ovary, spleen and heart. Also detected in lung, liver, brain, skeletal muscle, thymus, testis and intestine. Not detected in leukocytes. Isoform Beta expressed generally at very low levels. Isoform Alpha abundant in epithelial cells from mammary gland, prostate and in normal oral keratinocytes. Low levels in aortic endothelial cells and dermal fibroblasts. Not detectable in myocardium.
  • Sequence similarities

    Contains 1 LIM zinc-binding domain.
  • Domain

    Contains at least 2 actin-binding domains, one on each side of the LIM domain. Both domains bind actin monomers and filaments. The C-terminal domain binds filaments more efficiently than the N-terminus.
  • Cellular localization

    Cytoplasm. Cell junction > focal adhesion. Cytoplasm > cytoskeleton. This cytoskeletal protein co-localizes with actin stress fibers and focal adhesion plaques.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132150 on a 12.5% gel stained with Coomassie Blue.

References

ab132150 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132150.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up