For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-epo-protein-ab155618.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Growth Factors Other
Share by email

Recombinant Human EPO protein (ab155618)

  • Datasheet
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human EPO protein (ab155618)

    Key features and details

    • Expression system: HEK 293 cells
    • Purity: > 97% SDS-PAGE
    • Endotoxin level: < 1.000 Eu/µg
    • Suitable for: SDS-PAGE

    You may also be interested in

    ELISA
    Product image
    Human Erythropoietin ELISA Kit (EPO) (ab119522)
    Protein
    Recombinant human MMP1 protein (ab124850)
    ELISA
    Product image
    Rat MMP-2 ELISA Kit (ab213910)

    View more associated products

    Description

    • Product name

      Recombinant Human EPO protein
      See all EPO proteins and peptides
    • Purity

      > 97 % SDS-PAGE.

    • Endotoxin level

      < 1.000 Eu/µg
    • Expression system

      HEK 293 cells
    • Accession

      P01588
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA WKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVS GLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLR GKLKLYTGEACRTGDR
      • Predicted molecular weight

        18 kDa
      • Amino acids

        28 to 193

    Associated products

      Specifications

      Our Abpromise guarantee covers the use of ab155618 in the following tested applications.

      The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

      • Applications

        SDS-PAGE

      • Form

        Lyophilized
      • Concentration information loading...

      Preparation and Storage

      • Stability and Storage

        Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

        pH: 7.40
        Constituents: 95% PBS, 5% Trehalose

      • Reconstitution
        Reconstitute with sterile deionized water to a concentration of 400 µg/ml.

      General Info

      • Alternative names

        • EP
        • EPO
        • EPO alpha
        • Epoetin
        • Erythropoetin
        • Erythropoietin precursor
        • MVCD2
        see all
      • Relevance

        Human erythropoietin is member of the EPO/TPO family and encodes a secreted, glycosylated cytokine hormone composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
      • Cellular localization

        Secreted

      Images

      • SDS-PAGE - Recombinant Human EPO protein (ab155618)
        SDS-PAGE - Recombinant Human EPO protein (ab155618)

        SDS-PAGE analysis of reduced ab155618 stained overnight with Coomassie Blue. The protein has a calculated MW of 18.4 kDa. The protein migrates as 28-35 kDa under reducing (Lane 1) condition due to glycosylation.

      Protocols

      To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

      Click here to view the general protocols

      Datasheets and documents

      • Datasheet
    • References (0)

      Publishing research using ab155618? Please let us know so that we can cite the reference in this datasheet.

      ab155618 has not yet been referenced specifically in any publications.

      Customer reviews and Q&As

      Show All Reviews Q&A
      Submit a review Submit a question

      Question

      Would you be able to let me know the biological activity of the current batch of this and also whether it is in stock?
      Additionally, is this the correct EPO version if wanting to administer it to mice via intra-peritoneal injection to assess neurogenesis?
      I actually need 31 500IU of EPO so I'm not sure if the 10ug size will be enough?

      Read More

      Abcam community

      Verified customer

      Asked on Apr 29 2013

      Answer


      The quality control criteria for bioactivity of EPO is actually no less than 1.5x10e5 IU/mg.
      So If customer need 31,500 IU totally, around 210ug is required. Our recommendation is to order 5 vials x50ug to have some safety margin for this case.
      EPO product ab155618 is ready for any in vivo experiments as an active protein.
      We believe that EPO has been injected successfully to mice via various methods, including intra-peritoneal injection, but we are not sure if neurogenesis will occur as expected.

      Read More

      Abcam Scientific Support

      Answered on Apr 29 2013

      Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
      For licensing inquiries, please contact partnerships@abcam.com

      Get resources and offers direct to your inbox Sign up
      A-Z by research area
      • Cancer
      • Cardiovascular
      • Cell biology
      • Developmental biology
      • Epigenetics & Nuclear signaling
      • Immunology
      • Metabolism
      • Microbiology
      • Neuroscience
      • Signal transduction
      • Stem cells
      A-Z by product type
      • Primary antibodies
      • Secondary antibodies
      • Biochemicals
      • Isotype controls
      • Flow cytometry multi-color selector
      • Kits
      • Loading controls
      • Lysates
      • Peptides
      • Proteins
      • Slides
      • Tags and cell markers
      • Tools & Reagents
      Help & support
      • Support
      • Make an Inquiry
      • Protocols & troubleshooting
      • Placing an order
      • RabMAb products
      • Biochemical product FAQs
      • Training
      • Browse by Target
      Company
      • Corporate site
      • Investor relations
      • Company news
      • Careers
      • About us
      • Blog
      Events
      • Tradeshows
      • Conferences
      International websites
      • abcam.cn
      • abcam.co.jp

      Join with us

      • LinkedIn
      • facebook
      • Twitter
      • YouTube
      • Terms of sale
      • Website terms of use
      • Cookie policy
      • Privacy policy
      • Legal
      • Modern slavery statement
      © 1998-2021 Abcam plc. All rights reserved.