Bioactive grade

Recombinant human EPO protein (Fc Chimera Active) (ab243758)

Description

  • Product name

    Recombinant human EPO protein (Fc Chimera Active)
    See all EPO proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard. The specific activity was measured by the stimulation of reticulocyte production in normocyth-aemic mice and is no less than 5.0 × 10^5 IU/mg.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYA WKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVS GLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLR GKLKLYTGEACRTGDR+IEGRMDEPKSSDKTHTCPPCPAPEFEGAPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPTPIEKTISKAKGQ PREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      28 to 193
    • Tags

      Fc tag C-Terminus
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab243758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituent: PBS

    0.2 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at = -20degC. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • EP
    • EPO
    • EPO alpha
    • Epoetin
    • Erythropoetin
    • Erythropoietin precursor
    • MVCD2
    see all
  • Relevance

    Human erythropoietin is member of the EPO/TPO family and encodes a secreted, glycosylated cytokine hormone composed of four alpha helical bundles. The protein is found in the plasma and regulates red cell production by promoting erythroid differentiation and initiating hemoglobin synthesis. This protein also has neuroprotective activity against a variety of potential brain injuries and antiapoptotic functions in several tissue types. It is produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
  • Cellular localization

    Secreted

Images

  • SDS Page analysis of EPO with ab243758.

References

ab243758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up