Bioactive grade

Recombinant human EPO-R protein (Active) (ab219430)

Submit a review Submit a question

Description

  • Product name

    Recombinant human EPO-R protein (Active)
    See all EPO-R proteins and peptides

  • Biological activity

    Measured by its ability to inhibit EPO dependent proliferation using TF-1 human erythroleukemic cells. The ED50 for this effect is less or equal to 70ng/ml.

  • Purity

    > 95 % SDS-PAGE.
    ab219430 was purified using conventional chromatography techniques.

  • Endotoxin level

    < 1.000 Eu/µg

  • Expression system

    Baculovirus infected insect cells

  • Accession

    P19235

  • Protein length

    Protein fragment

  • Animal free

    No

  • Nature

    Recombinant

    • Species

      Human

    • Sequence

      APPPNLPDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGP GNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRV TAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPM TSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARM AEPSFGGFWSAWSEPVSLLTPSDLDPHHHHHH

    • Predicted molecular weight

      26 kDa including tags

    • Amino acids

      25 to 250

    • Tags

      His tag C-Terminus

    • Additional sequence information

      Extracellular domain (NP_000112.1).

Specifications

Our Abpromise guarantee covers the use of ab219430 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid

  • Additional notes

    Previously labelled as EPO Receptor. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, 90% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • EPO R
    • EPO Receptor
    • EPO-R
    • epor
    • EPOR_HUMAN
    • Erythropoietin receptor
    • Erythropoietin receptor precursor
    • MGC138358
    see all

  • Function

    Receptor for erythropoietin. Mediates erythropoietin-induced erythroblast proliferation and differentiation. Upon EPO stimulation, EPOR dimerizes triggering the JAK2/STAT5 signaling cascade. In some cell types, can also activate STAT1 and STAT3. May also activate the LYN tyrosine kinase.
    Isoform EPOR-T acts as a dominant-negative receptor of EPOR-mediated signaling.

  • Tissue specificity

    Erythroid cells and erythroid progenitor cells. Isoform EPOR-F is the most abundant form in EPO-dependent erythroleukemia cells and in late-stage erythroid progenitors. Isoform EPOR-S and isoform EPOR-T are the predominant forms in bone marrow. Isoform EPOR-T is the most abundant from in early-stage erythroid progenitor cells.

  • Involvement in disease

    Defects in EPOR are the cause of erythrocytosis familial type 1 (ECYT1) [MIM:133100]. ECYT1 is an autosomal dominant disorder characterized by increased serum red blood cell mass, elevated hemoglobin and hematocrit, hypersensitivity of erythroid progenitors to erythropoietin, erythropoietin low serum levels, and no increase in platelets nor leukocytes. It has a relatively benign course and does not progress to leukemia.

  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 1 subfamily.
    Contains 1 fibronectin type-III domain.

  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.

  • Post-translational
    modifications

    On EPO stimulation, phosphorylated on C-terminal tyrosine residues by JAK2. The phosphotyrosine motifs are also recruitment sites for several SH2-containing proteins and adapter proteins which mediate cell proliferation. Phosphorylation on Tyr-454 is required for PTPN6 interaction, Tyr-426 for PTPN11. Tyr-426 is also required for SOCS3 binding, but Tyr-454/Tyr-456 motif is the preferred binding site.
    Ubiquitinated by NOSIP; appears to be either multi-monoubiquitinated or polyubiquitinated. Ubiquitination mediates proliferation and survival of EPO-dependent cells.

  • Cellular localization

    Cell membrane and Secreted. Secreted and located to the cell surface.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant human EPO-R protein (Active) (ab219430)
    SDS-PAGE - Recombinant human EPO-R protein (Active) (ab219430)

    15% SDS-PAGE analysis of 3 μg ab219430.

    Molecular Weight: 28-40 kDa (SDS-PAGE under reducing conditions).

References

ab219430 has not yet been referenced specifically in any publications.

Publishing research using ab219430? Please let us know so that we can cite the reference in this datasheet.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab219430.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com