Description

  • Product name

    Recombinant Human EPPIN protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSGLLSLLVLFVLLANVQGPGLTDWLFPRRCPKIREECEFQERDVCTK DRQCQDNKKCCVFSCGKKCLDLKQDVCEMPKETGPCLAYFLHWWYDKKDN TCSMFVYGGCQGNNNNFQSKANCLNTCKNKRFP
    • Amino acids

      1 to 133
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as SPINLW1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cancer/testis antigen 71
    • CT 71
    • CT71
    • dJ461P17.2
    • Epididymal protease inhibitor
    • EPPI_HUMAN
    • EPPIN
    • EPPIN 1
    • EPPIN 2
    • EPPIN 3
    • EPPIN1
    • EPPIN2
    • EPPIN3
    • Protease inhibitor WAP7
    • Serine peptidase inhibitor like with Kunitz and WAP domains 1
    • Serine peptidase inhibitor like with Kunitz and WAP domains 1 (eppin)
    • Serine protease inhibitor-like with Kunitz and WAP domains 1
    • SPINLW 1
    • WAP 7
    • WAP four disulfide core domain 7
    • WAP four disulfide core domain protein 7
    • WAP four-disulfide core domain protein 7
    • WAP7
    • WFDC 7
    • WFDC7
    see all
  • Function

    Serine protease inhibitor that plays an essential role in male reproduction and fertility. Modulates the hydrolysis of SEMG1 by KLK3/PSA (a serine protease), provides antimicrobial protection for spermatozoa in the ejaculate coagulum, and binds SEMG1 thereby inhibiting sperm motility.
  • Tissue specificity

    In testis, expressed and secreted by Sertoli cells, appearing on the surface of testicular and ejaculate spermatozoa. Expressed in the spermatogonia and the earliest preleptotene spermatocytes. In the epididymis, is expressed and secreted by epithelial cells and covers the surface of epididymal spermatozoa and ciliated epithelial cells (at protein level). Expressed specifically in epididymis and testis. Isoform 2 is expressed only in the epididymis. Weak expression is detected in myoid cells as well as spermatogenic cells.
  • Sequence similarities

    Contains 1 BPTI/Kunitz inhibitor domain.
    Contains 1 WAP domain.
  • Domain

    The BPTI/Kunitz inhibitor domain is required for elastase inhibitory activity. BPTI/Kunitz inhibitor and WAP domains are involved in the protein antibacterial activity.
  • Cellular localization

    Secreted. Cell surface. Bound to the surface of testicular and on the head and tail of ejaculate spermatozoa.
  • Information by UniProt

Images

  • ab163490 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up