Overview

  • Product name
    Recombinant Human Epsin 2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNV VAFSEIMSMVWKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENI F
    • Amino acids
      1 to 101
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161471 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EHB21
    • EPN 2
    • Epn2
    • EPN2_HUMAN
    • EPS 15 interacting protein 2
    • EPS-15-interacting protein 2
    • Eps15 binding protein
    • Epsin 2
    • Epsin-2
    • Epsin2
    • KIAA1065
    • OTTHUMP00000065808
    • OTTHUMP00000065809
    • OTTHUMP00000065810
    • OTTHUMP00000065811
    • OTTHUMP00000065889
    see all
  • Function
    Plays a role in the formation of clathrin-coated invaginations and endocytosis.
  • Tissue specificity
    Highest expression is found in brain. Detected at lower levels in lung and liver.
  • Sequence similarities
    Belongs to the epsin family.
    Contains 1 ENTH (epsin N-terminal homology) domain.
    Contains 2 UIM (ubiquitin-interacting motif) repeats.
  • Domain
    The NPF repeat domain is involved in EPS15 binding.
    The DPW repeat domain is involved in AP-2 and clathrin binding.
  • Post-translational
    modifications
    Ubiquitinated.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle > clathrin-coated vesicle. In punctate structures throughout the cell, associated with clathrin-coated vesicles, and particularly concentrated in the region of the Golgi complex.
  • Information by UniProt

Images

  • ab161471 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161471 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161471.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up