Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      PGFRPNTEASGSSWGPSADPWSPIPSGTVLSRSQPWDLTPMLSSSEPWGR TPVLPAGPPTTDPWALNSPHYKLPSTGADPWGASLETSDTPGGASTFDPF A
    • Amino acids

      326 to 426
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as EPN3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EPN 3
    • Epn3
    • EPN3_HUMAN
    • EPS 15 interacting protein 3
    • EPS-15-interacting protein 3
    • Epsin 3
    • Epsin-3
    • Epsin3
    • FLJ20778
    • MGC129899
    see all
  • Tissue specificity

    Detected in migrating keratinocytes from wounded skin, but not in differentiating keratinocytes or in normal skin. Detected in chronic wounds, basal cell carcinoma and ulcerative colitis.
  • Sequence similarities

    Belongs to the epsin family.
    Contains 1 ENTH (epsin N-terminal homology) domain.
    Contains 2 UIM (ubiquitin-interacting motif) domains.
  • Cellular localization

    Cytoplasm. Cytoplasm, perinuclear region. Cytoplasmic vesicle, clathrin-coated vesicle. Nucleus. Concentrated in the perinuclear region and associated with clathrin-coated vesicles close to the cell periphery. May shuttle to the nucleus.
  • Information by UniProt

Images

  • ab162944 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up