Recombinant human ErbB 2 (mutated G776 V + G776 C) protein (Cytoplasmic domain) (ab191466)

Description

  • Product name

    Recombinant human ErbB 2 (mutated G776 V + G776 C) protein (Cytoplasmic domain)
    See all ErbB 2 proteins and peptides
  • Biological activity

    Specific activity: 5 nmol/min/mg.

  • Purity

    > 75 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETELRKVKV LGSGAFGTVY KGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYV MAGVGSPYVSRLLGICLTSTVQ LVTQLMPYGCLLDHVRENRGRLGSQD LLNWCMQIAKGMSYLEDVRLVHRDLAARNVLVKS PNHVKITDFGLARL LDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWEL MT FGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWMIDSECRP RFRELVSE FSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMG DLVDAEEYLVPQQGFFCPDP APGAGGMVHHRHRSSSTRSGGGDLTLGL EPSEEEAPRSPLAPSEGAGSDVFDGDLGMGAA KGLQSLPTHDPSPLQR YSEDPTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREG PLPA ARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHP PPAFSP AFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
    • Predicted molecular weight

      115 kDa including tags
    • Amino acids

      676 to 1255
    • Modifications

      mutated G776 V + G776 C
    • Tags

      proprietary tag N-Terminus
    • Additional sequence information

      Cytoplasmic domain.

Specifications

Our Abpromise guarantee covers the use of ab191466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.307% Glutathione, 0.00292% EDTA, 0.00385% DTT, 25% Glycerol, 0.002% PMSF

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog
    • C erb B2/neu protein
    • CD340
    • CD340 antigen
    • Cerb B2/neu protein
    • CerbB2
    • Erb b2 receptor tyrosine kinase 2
    • ErbB-2 proto-oncogene
    • ERBB2
    • ERBB2_HUMAN
    • HER 2
    • HER 2/NEU
    • HER2
    • Herstatin
    • Human epidermal growth factor receptor 2
    • Metastatic lymph node gene 19 protein
    • MLN 19
    • MLN19
    • NEU
    • NEU proto oncogene
    • Neuro/glioblastoma derived oncogene homolog
    • Neuroblastoma/glioblastoma derived oncogene homolog
    • NGL
    • p185erbB2
    • Proto-oncogene c-ErbB-2
    • Proto-oncogene Neu
    • Receptor tyrosine-protein kinase erbB-2
    • TKR1
    • Tyrosine kinase type cell surface receptor HER2
    • Tyrosine kinase-type cell surface receptor HER2
    • V erb b2 avian erythroblastic leukemia viral oncogene homolog 2
    • V erb b2 avian erythroblastic leukemia viral oncogene homolog 2 (neuro/glioblastoma derived oncogene homolog)
    • V erb b2 avian erythroblastic leukemia viral oncoprotein 2
    • V erb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog
    • V erb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
    • Verb b2 erythroblastic leukemia viral oncogene homolog 2, neuro/glioblastoma derived oncogene homolog (avian)
    see all
  • Function

    Protein tyrosine kinase that is part of several cell surface receptor complexes, but that apparently needs a coreceptor for ligand binding. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. GP30 is a potential ligand for this receptor. Regulates outgrowth and stabilization of peripheral microtubules (MTs). Upon ERBB2 activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits the phosphorylation and thus the inhibition of GSK3B at cell membrane. This prevents the phosphorylation of APC and CLASP2, allowing its association with the cell membrane. In turn, membrane-bound APC allows the localization of MACF1 to the cell membrane, which is required for microtubule capture and stabilization.
    In the nucleus is involved in transcriptional regulation. Associates with the 5'-TCAAATTC-3' sequence in the PTGS2/COX-2 promoter and activates its transcription. Implicated in transcriptional activation of CDKN1A; the function involves STAT3 and SRC. Involved in the transcription of rRNA genes by RNA Pol I and enhances protein synthesis and cell growth.
  • Tissue specificity

    Expressed in a variety of tumor tissues including primary breast tumors and tumors from small bowel, esophagus, kidney and mouth.
  • Involvement in disease

    Hereditary diffuse gastric cancer
    Glioma
    Ovarian cancer
    Lung cancer
    Gastric cancer
    Chromosomal aberrations involving ERBB2 may be a cause gastric cancer. Deletions within 17q12 region producing fusion transcripts with CDK12, leading to CDK12-ERBB2 fusion leading to truncated CDK12 protein not in-frame with ERBB2.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated. Autophosphorylation occurs in trans, i.e. one subunit of the dimeric receptor phosphorylates tyrosine residues on the other subunit (Probable). Ligand-binding increases phosphorylation on tyrosine residues (PubMed:27134172). Signaling via SEMA4C promotes phosphorylation at Tyr-1248 (PubMed:17554007). Dephosphorylated by PTPN12 (PubMed:27134172).
  • Cellular localization

    Cytoplasm. Nucleus and Cell membrane. Cytoplasm, perinuclear region. Nucleus. Translocation to the nucleus requires endocytosis, probably endosomal sorting and is mediated by importin beta-1/KPNB1.
  • Information by UniProt

Images

  • The specific activity of ErbB 2 (ab191466) was determined to be 175 nmol/min/mg as per activity assay protocol and was equivalent to 6 nmol/min/mg as per radiometric assay
  • SDS PAGE analysis of ab191466
  • SDS PAGE analysis of ab191466
  • SDS-PAGE of ErbB 2 (mutated G776 VC). Approx MW 115 kDa.

  • Specific Activity: Sample Kinase Activity Plot. ErbB 2 (mutated G776 VC) activity assay with or without substrate Poly (Glu:Tyr, 4:1) peptide. The specific activity of ErbB 2 (mutated G776 VC) was determined to be 5 nmol /min/mg.

References

ab191466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up