Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGH NADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDR DAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFG PNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTF QLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMC EPCGGLCPKAF
    • Molecular weight

      60 kDa including tags
    • Amino acids

      21 to 331

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131831 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8,00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • c erbB 3
    • c erbB3
    • Erb b2 receptor tyrosine kinase 3
    • ErbB 3
    • ERBB3
    • ERBB3 protein
    • erbB3 S
    • ERBB3_HUMAN
    • Glial growth factor receptor
    • HER 3
    • HER3
    • Human epidermal growth factor receptor 3
    • LCCS2
    • MDA BF 1
    • MGC88033
    • p180 ErbB3
    • p45 sErbB3
    • p85 sErbB3
    • proto-oncogene-like protein c ErbB 3
    • proto-oncogene-like protein c ErbB3
    • Proto-oncogene-like protein c-ErbB-3
    • Receptor tyrosine protein kinase erbB 3
    • Receptor tyrosine protein kinase erbB3
    • Receptor tyrosine-protein kinase erbB-3
    • Tyrosine kinase type cell surface receptor HER3
    • Tyrosine kinase-type cell surface receptor HER3
    • v erb b2 avian erythroblastic leukemia viral oncogene homolog 3
    • v erb b2 erythroblastic leukemia viral oncogene homolog 3
    • v erb b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
    see all
  • Function

    Binds and is activated by neuregulins and NTAK.
  • Tissue specificity

    Epithelial tissues and brain.
  • Involvement in disease

    Defects in ERBB3 are the cause of lethal congenital contracture syndrome type 2 (LCCS2) [MIM:607598]; also called Israeli Bedouin multiple contracture syndrome type A. LCCS2 is an autosomal recessive neurogenic form of a neonatally lethal arthrogryposis that is associated with atrophy of the anterior horn of the spinal cord. The LCCS2 syndrome is characterized by multiple joint contractures, anterior horn atrophy in the spinal cord, and a unique feature of a markedly distended urinary bladder. The phenotype suggests a spinal cord neuropathic etiology.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.
    Contains 1 protein kinase domain.
  • Developmental stage

    Overexpressed in a subset of human mammary tumors.
  • Domain

    The cytoplasmic part of the receptor may interact with the SH2 or SH3 domains of many signal-transducing proteins.
  • Post-translational
    modifications

    Ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131831 stained with Coomassie Blue.

References

ab131831 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131831.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up