Description

  • Product name

    Recombinant Human ErbB 3 protein
    See all ErbB 3 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The purity of ab196072 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTG HNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFV MLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRD RDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCF GPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLT FQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKM CEPCGGLCPKAFVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK
    • Predicted molecular weight

      62 kDa including tags
    • Amino acids

      20 to 330
    • Additional sequence information

      FC tag at the C terminus.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab196072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. The lyophilized protein is stable for a few weeks at room temperature. Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Lyophlized from an 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • c erbB 3
    • c erbB3
    • Erb b2 receptor tyrosine kinase 3
    • ErbB 3
    • ERBB3
    • ERBB3 protein
    • erbB3 S
    • ERBB3_HUMAN
    • Glial growth factor receptor
    • HER 3
    • HER3
    • Human epidermal growth factor receptor 3
    • LCCS2
    • MDA BF 1
    • MGC88033
    • p180 ErbB3
    • p45 sErbB3
    • p85 sErbB3
    • proto-oncogene-like protein c ErbB 3
    • proto-oncogene-like protein c ErbB3
    • Proto-oncogene-like protein c-ErbB-3
    • Receptor tyrosine protein kinase erbB 3
    • Receptor tyrosine protein kinase erbB3
    • Receptor tyrosine-protein kinase erbB-3
    • Tyrosine kinase type cell surface receptor HER3
    • Tyrosine kinase-type cell surface receptor HER3
    • v erb b2 avian erythroblastic leukemia viral oncogene homolog 3
    • v erb b2 erythroblastic leukemia viral oncogene homolog 3
    • v erb b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
    see all
  • Function

    Binds and is activated by neuregulins and NTAK.
  • Tissue specificity

    Epithelial tissues and brain.
  • Involvement in disease

    Defects in ERBB3 are the cause of lethal congenital contracture syndrome type 2 (LCCS2) [MIM:607598]; also called Israeli Bedouin multiple contracture syndrome type A. LCCS2 is an autosomal recessive neurogenic form of a neonatally lethal arthrogryposis that is associated with atrophy of the anterior horn of the spinal cord. The LCCS2 syndrome is characterized by multiple joint contractures, anterior horn atrophy in the spinal cord, and a unique feature of a markedly distended urinary bladder. The phenotype suggests a spinal cord neuropathic etiology.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.
    Contains 1 protein kinase domain.
  • Developmental stage

    Overexpressed in a subset of human mammary tumors.
  • Domain

    The cytoplasmic part of the receptor may interact with the SH2 or SH3 domains of many signal-transducing proteins.
  • Post-translational
    modifications

    Ligand-binding increases phosphorylation on tyrosine residues and promotes its association with the p85 subunit of phosphatidylinositol 3-kinase.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

References

ab196072 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up