Description

  • Product name

    Recombinant Human ErbB 4 protein (Fc Chimera)
    See all ErbB 4 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLS FLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRK DGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNL TLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPY VSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQL EHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKP CTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHG DPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGG RVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWT TLFSTINQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRR FSRGRICIESCNLYDGEFREFENGSICVECDPQCEKMEDGLLTCHGPGPD NCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGC NGPTSHDCIYYPWTGHSTLPQHARTP
    • Predicted molecular weight

      96 kDa including tags
    • Amino acids

      26 to 651
    • Additional sequence information

      Extracellular domain fused with a human IgG1 Fc tag at the C-terminus (NP_001036064.1).

Specifications

Our Abpromise guarantee covers the use of ab219711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine

    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%. Lyophilised from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilised product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 4ICD
    • ALS19
    • Avian erythroblastic leukemia viral oncogene homolog 4
    • Avian erythroblastic leukemia viral v erb b2 oncogene homolog 4
    • E4ICD
    • EC 2.7.10.1
    • Erbb4
    • ERBB4 intracellular domain
    • ERBB4_HUMAN
    • HER 4
    • HER4
    • human epidermal growth factor receptor 4
    • Mer4
    • MGC138404
    • Oncogene ERBB4
    • p180erbB4
    • Proto-oncogene-like protein c-ErbB-4
    • Receptor protein tyrosine kinase erbB 4 precursor
    • Receptor tyrosine protein kinase erbB 4
    • s80HER4
    • Tyrosine kinase type cell surface receptor HER4
    • Tyrosine kinase-type cell surface receptor HER4
    • v erb a avian erythroblastic leukemia viral oncogene homolog like 4
    • v erb a erythroblastic leukemia viral oncogene homolog 4
    • v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian)
    • V-ERB-B2 avian erythroblastic leukemia viral oncogene homolog 4
    • Verba avian erythroblastic leukemia viral oncogene homolog like 4
    • Verba erythroblastic leukemia viral oncogene homolog 4
    • VERBB2
    see all
  • Function

    Specifically binds and is activated by neuregulins, NRG-2, NRG-3, heparin-binding EGF-like growth factor, betacellulin and NTAK. Interaction with these factors induces cell differentiation. Not activated by EGF, TGF-A, and amphiregulin. The C-terminal fragment (CTF) of isoform JMA-A CYT-2 (containing E4ICD2) can stimulate transcription in the presence of YAP1. ERBB4 intracellular domain is involved in the regulation of cell growth. Conflicting reports are likely due at least in part to the opposing effects of the isoform-specific and nuclear-translocated ERBB4 intracellular domains (E4ICD1 and E4ICD2). Overexpression studies in epithelium show growth inhibition using E4ICD1 and increased proliferation using E4ICD2. E4ICD2 has greater in vitro kinase activity than E4ICD1. The kinase activity is required for the nuclear translocation of E4ICD2.
  • Tissue specificity

    Expressed at highest levels in brain, heart, kidney, in addition to skeletal muscle, parathyroid, cerebellum, pituitary, spleen, testis and breast. Lower levels in thymus, lung, salivary gland, and pancreas. Isoform JM-A CYT-1 and isoform JM-B CYT-1 are expressed in cerebellum, but only the isoform JM-B is expressed in the heart.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Isoform JM-A CYT-1 and isoform JM-A CYT-2 but not isoform JM-B CYT-1 and isoform JM-B CYT-2 are processed by ADAM17. Proteolytic processing in response to ligand or 12-O-tetradecanoylphorbol-13-acetate stimulation results in the production of 120 kDa soluble receptor forms and intermediate membrane-anchored 80 kDa fragments (m80HER4), which are further processed by a presenilin-dependent gamma-secretase to release the respective cytoplasmic intracellular domain E4ICD (either E4ICD1/s80Cyt1 or E4ICD2/s80Cyt2). Membrane-anchored 80 kDa fragments of the processed isoform JM-A CYT-1 are more readily degraded by the proteasome than fragments of isoform JM-A CYT-2 suggesting a prevalence of E4ICD2 over E4ICD1.
    Ligand-binding increases phosphorylation on tyrosine residues. Isoform JM-A CYT-2 is constitutively phosphorylated on tyrosine residues in a ligand-independent manner. E4ICD2 but not E4ICD1 is phosphorylated on tyrosine residues.
    Ubiquitinated. The ERBB4 intracellular domain is ubiquitinated and targeted to proteosomal degradation during mitosis mediated by the APC/C complex. Isoform JM-A CYT-1 and isoform JM-B CYT-1 are ubiquitinated by WWP1. The ERBB4 intracellular domain (E4ICD1) is ubiquitinated, and this involves NEDD4.
  • Cellular localization

    Membrane and Nucleus. Following proteolytical processing E4ICD (E4ICD1 or E4ICD2 generated from the respective isoforms) is translocated to the nucleus. Significantly more E4ICD2 than E4ICD1 is found in the nucleus. E4ICD2 colocalizes with YAP1 in the nucleus.
  • Information by UniProt

Images

  • DTT-reduced SDS-PAGE analysis of ab219711 stained overnight with Coomassie Blue.

    DTT-reduced protein migrates as 122-132 kDa in SDS-PAGE due to glycosylation.

References

ab219711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up