For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-erbb4--her4-protein-ab155610.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Protein Phosphorylation Tyrosine Kinases Receptor Tyrosine Kinases
Share by email
Bioactive grade

Recombinant human ErbB4 / HER4 protein (ab155610)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human ErbB4 / HER4 protein (ab155610)
  • Functional Studies - Recombinant human ErbB4 / HER4 protein (ab155610)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Tags: His tag C-Terminus
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

ELISA
Product image
Human ErbB 4 ELISA Kit (ab267600)
Primary
Product image
Anti-ErbB4 / HER4 antibody [E200] (ab32375)
Protein
Product image
Recombinant human ErbB2 / HER2 protein (Active) (ab60866)

View more associated products

Description

  • Product name

    Recombinant human ErbB4 / HER4 protein
    See all ErbB4 / HER4 proteins and peptides
  • Biological activity

    Measured by its ability to inhibit the biological activity of Neuregulin-1-ß1 on MCF7 Human breast cancer cells. In the presence of 10 ng/ml of Recombinant Human NRG1-ß1/HRG1-ß1 Extracellular Domain.

    The ED50 for this effect is typically 0.2-2.5 µg/ml.
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    Q15303
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLS FLRSVREVTG YVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNY RKDGNFGLQELGLKNLTEILNG GVYVDQNKFLCYADTIHWQDIVRNPW PSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHC QTLTRTVCAEQCDG RCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQT FV YNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEE NGIKMCKP CTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGN LIFLVTGIHGDPYNAIEAID PEKLNVFRTVREITGFLNIQSWPPNMTD FSVFSNLVTIGGRVLYSGLSLLILKQQGITSL QFQSLKEISAGNIYIT DNSNLCYYHTINWTTLFSTINQRIVIRDNRKAENCTAEGMVCNH LCSS DGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQC EKMEDG LLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKY ADPDRECHPCHPNCTQGC NGPTSHDCIYYPWTGHSTLPQHARTP
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      26 to 651
    • Tags

      His tag C-Terminus

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab155610 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 200ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • 4ICD
    • ALS19
    • Avian erythroblastic leukemia viral oncogene homolog 4
    • Avian erythroblastic leukemia viral v erb b2 oncogene homolog 4
    • E4ICD
    • EC 2.7.10.1
    • ErbB 4
    • Erbb4
    • ERBB4 intracellular domain
    • ERBB4_HUMAN
    • HER 4
    • HER4
    • human epidermal growth factor receptor 4
    • Mer4
    • MGC138404
    • Oncogene ERBB4
    • p180erbB4
    • Proto-oncogene-like protein c-ErbB-4
    • Receptor protein tyrosine kinase erbB 4 precursor
    • Receptor tyrosine protein kinase erbB 4
    • s80HER4
    • Tyrosine kinase type cell surface receptor HER4
    • Tyrosine kinase-type cell surface receptor HER4
    • v erb a avian erythroblastic leukemia viral oncogene homolog like 4
    • v erb a erythroblastic leukemia viral oncogene homolog 4
    • v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian)
    • V-ERB-B2 avian erythroblastic leukemia viral oncogene homolog 4
    • Verba avian erythroblastic leukemia viral oncogene homolog like 4
    • Verba erythroblastic leukemia viral oncogene homolog 4
    • VERBB2
    see all
  • Function

    Specifically binds and is activated by neuregulins, NRG-2, NRG-3, heparin-binding EGF-like growth factor, betacellulin and NTAK. Interaction with these factors induces cell differentiation. Not activated by EGF, TGF-A, and amphiregulin. The C-terminal fragment (CTF) of isoform JMA-A CYT-2 (containing E4ICD2) can stimulate transcription in the presence of YAP1. ERBB4 intracellular domain is involved in the regulation of cell growth. Conflicting reports are likely due at least in part to the opposing effects of the isoform-specific and nuclear-translocated ERBB4 intracellular domains (E4ICD1 and E4ICD2). Overexpression studies in epithelium show growth inhibition using E4ICD1 and increased proliferation using E4ICD2. E4ICD2 has greater in vitro kinase activity than E4ICD1. The kinase activity is required for the nuclear translocation of E4ICD2.
  • Tissue specificity

    Expressed at highest levels in brain, heart, kidney, in addition to skeletal muscle, parathyroid, cerebellum, pituitary, spleen, testis and breast. Lower levels in thymus, lung, salivary gland, and pancreas. Isoform JM-A CYT-1 and isoform JM-B CYT-1 are expressed in cerebellum, but only the isoform JM-B is expressed in the heart.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. EGF receptor subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Isoform JM-A CYT-1 and isoform JM-A CYT-2 but not isoform JM-B CYT-1 and isoform JM-B CYT-2 are processed by ADAM17. Proteolytic processing in response to ligand or 12-O-tetradecanoylphorbol-13-acetate stimulation results in the production of 120 kDa soluble receptor forms and intermediate membrane-anchored 80 kDa fragments (m80HER4), which are further processed by a presenilin-dependent gamma-secretase to release the respective cytoplasmic intracellular domain E4ICD (either E4ICD1/s80Cyt1 or E4ICD2/s80Cyt2). Membrane-anchored 80 kDa fragments of the processed isoform JM-A CYT-1 are more readily degraded by the proteasome than fragments of isoform JM-A CYT-2 suggesting a prevalence of E4ICD2 over E4ICD1.
    Ligand-binding increases phosphorylation on tyrosine residues. Isoform JM-A CYT-2 is constitutively phosphorylated on tyrosine residues in a ligand-independent manner. E4ICD2 but not E4ICD1 is phosphorylated on tyrosine residues.
    Ubiquitinated. The ERBB4 intracellular domain is ubiquitinated and targeted to proteosomal degradation during mitosis mediated by the APC/C complex. Isoform JM-A CYT-1 and isoform JM-B CYT-1 are ubiquitinated by WWP1. The ERBB4 intracellular domain (E4ICD1) is ubiquitinated, and this involves NEDD4.
  • Cellular localization

    Membrane and Nucleus. Following proteolytical processing E4ICD (E4ICD1 or E4ICD2 generated from the respective isoforms) is translocated to the nucleus. Significantly more E4ICD2 than E4ICD1 is found in the nucleus. E4ICD2 colocalizes with YAP1 in the nucleus.
  • Target information above from: UniProt accession Q15303 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant human ErbB4 / HER4 protein (ab155610)
    SDS-PAGE - Recombinant human ErbB4 / HER4 protein (ab155610)
    Human ErbB4, His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • Functional Studies - Recombinant human ErbB4 / HER4 protein (ab155610)
    Functional Studies - Recombinant human ErbB4 / HER4 protein (ab155610)

    Immobilsed ab155610 at 2 μg/mL (100 μL/well) can bind Human NRG1 Beta 1, Fc Tag with a linear range of 0.5-8 ng/mL

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

  • Datasheet download

    Download

References (0)

Publishing research using ab155610? Please let us know so that we can cite the reference in this datasheet.

ab155610 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Show All Reviews Q&A
Submit a review Submit a question

There are currently no Customer reviews or Questions for ab155610.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Get resources and offers direct to your inbox Sign up
A-Z by research area
  • Cancer
  • Cardiovascular
  • Cell biology
  • Developmental biology
  • Epigenetics & Nuclear signaling
  • Immunology
  • Metabolism
  • Microbiology
  • Neuroscience
  • Signal transduction
  • Stem cells
A-Z by product type
  • Primary antibodies
  • Secondary antibodies
  • Biochemicals
  • Isotype controls
  • Flow cytometry multi-color selector
  • Kits
  • Loading controls
  • Lysates
  • Peptides
  • Proteins
  • Slides
  • Tags and cell markers
  • Tools & Reagents
Help & support
  • Support
  • Make an Inquiry
  • Protocols & troubleshooting
  • Placing an order
  • RabMAb products
  • Biochemical product FAQs
  • Training
  • Browse by Target
Company
  • Corporate site
  • Investor relations
  • Company news
  • Careers
  • About us
  • Blog
Events
  • Tradeshows
  • Conferences
International websites
  • abcam.cn
  • abcam.co.jp

Join with us

  • LinkedIn
  • facebook
  • Twitter
  • YouTube
  • Terms of sale
  • Website terms of use
  • Cookie policy
  • Privacy policy
  • Legal
  • Modern slavery statement
© 1998-2023 Abcam plc. All rights reserved.