Overview

  • Product name
    Recombinant Human ERCC6L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEKSFATKNEAVQKETLQEGPKQEALQEDPLESFNYVLSKSTKADIGPNL DQLKDDEILRHCNPWPIISITNESQNAESNVSIIEIADDLSASHSALQDA QASEAKLEEEPSASSPQYACDFNLFLEDSADNRQNFSSQSLEHVEKENSL CGSAPNSRAGFVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGE DEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPPGRFFSSQIPS SVNKSMNSRRSLASRRSLINMVLDHVEDMEERLDDSSEAKGPEDYPEEGV EESSGEASKYTEEDPSGETLSSENKSSWLMTSKPSALAQETSLGAPEPLS GEQLVGSPQDKAAEATNDYETLVKRGKELKECGKIQEALNCLVKALDIKS ADPEVMLLTLSLYKQLNNN
    • Amino acids
      1 to 419
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent helicase ERCC6 like
    • ATP-dependent helicase ERCC6-like
    • DNA excision repair protein ERCC 6 like
    • DNA excision repair protein ERCC-6-like
    • ERC6L_HUMAN
    • ERCC 6L
    • Ercc6l
    • Excision repair cross complementing rodent repair deficiency complementation group 6 like
    • Excision repair protein ERCC6 like
    • FLJ20105
    • MGC131695
    • PICH
    • Plk1 interacting checkpoint helicase
    • PLK1-interacting checkpoint helicase
    • SNF2/RAD54 family protein
    • Tumor antigen BJ HCC 15
    • Tumor antigen BJ-HCC-15
    see all
  • Function
    DNA helicase that acts as an essential component of the spindle assembly checkpoint. Contributes to the mitotic checkpoint by recruiting MAD2 to kinetochores and monitoring tension on centromeric chromatin. Acts as a tension sensor that associates with catenated DNA which is stretched under tension until it is resolved during anaphase.
  • Sequence similarities
    Belongs to the SNF2/RAD54 helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 2 TPR repeats.
  • Post-translational
    modifications
    Phosphorylation by PLK1 prevents the association with chromosome arms and restricts its localization to the kinetochore-centromere region.
  • Cellular localization
    Chromosome > centromere. Chromosome > centromere > kinetochore. Localizes to kinetochores, inner centromeres and thin threads connecting separating chromosomes even during anaphase. In prometaphase cells, it mostly concentrates in between kinetochores. In metaphase, it localizes to numerous thin threads that stretch between sister kinetochores of the aligned chromosomes and are composed of catenated centromeric DNA. Evolution from inner centromeres to thin threads takes place in response to tension. Resolution of thin threads requires topoisomerase 2-alpha (TOP2A) after anaphase onset.
  • Information by UniProt

Images

  • ab162850 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up