Overview

  • Product name

    Recombinant Human eRF1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      TEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGA TLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
    • Molecular weight

      37 kDa including tags
    • Amino acids

      338 to 437

Specifications

Our Abpromise guarantee covers the use of ab116909 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cl1 protein
    • D5S1995
    • ERF
    • eRF1
    • ERF1_HUMAN
    • ETF1
    • Eukaryotic peptide chain release factor subunit 1
    • Eukaryotic release factor 1
    • Eukaryotic translation termination factor 1
    • MGC111066
    • Polypeptide chain release factor 1
    • Protein Cl1
    • RF1
    • Sup45 (yeast omnipotent suppressor 45) homolog like 1
    • SUP45L1
    • TB3 1
    • TB3-1
    see all
  • Function

    Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.
  • Sequence similarities

    Belongs to the eukaryotic release factor 1 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116909 at approximately 36.63 kDa.

References

ab116909 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116909.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up