Recombinant Human ERG protein (ab185597)
Key features and details
- Expression system: Escherichia coli
- Purity: > 90% SDS-PAGE
- Tags: His-T7 tag N-Terminus
- Suitable for: SDS-PAGE
Description
-
Product name
Recombinant Human ERG protein -
Purity
> 90 % SDS-PAGE.
ab185597 was expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology and chromatographically purified. -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MASMTGGQQMGRGHHHHHHENLYFQGSASTIKEALSVVSEDQSLFECAYG TPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQ VNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERR VIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKD DFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNT GGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQ PSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDS SNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYD KNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAH PQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSH LGTYYLEESGGGGSPGRRRRRRRRRRR -
Predicted molecular weight
59 kDa including tags -
Amino acids
2 to 479 -
Tags
His-T7 tag N-Terminus -
Additional sequence information
Contructed with a T7-His-TEV cleavage site Tag (27 amino acids) fusion at the N-terminal and 11R tag at the C-terminal.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab185597 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
-
Form
Liquid -
Additional notes
1. May be used for in vitro ERG mediated HSC differentiation regulation study using either 11R mediated or “ProFectin” based intracellular delivery of this protein.
2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.
3. May be used for EGR protein-protein interaction mapping.
4. Potential diagnostic biomarker protein for monitoring various cancer treatment outcomes.
5. As immunogen for specific antibody production.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
pH: 8.00
Constituent: 0.32% Tris HCl
Contains NACl, EDTA, KCl, arginine, DTT and glycerol
General Info
-
Alternative names
- Avian erythroblastosis virus E-26 (v-ets) oncogene related
- D030036I24Rik
- Erg
see all -
Function
Transcriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure. -
Involvement in disease
Defects in ERG are a cause of Ewing sarcoma (ES) [MIM:612219]. A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. Note=A chromosomal aberration involving ERG is found in patients with Erwing sarcoma. Translocation t(21;22)(q22;q12) with EWSR1.
Note=Chromosomal aberrations involving ERG have been found in acute myeloid leukemia (AML). Translocation t(16;21)(p11;q22) with FUS. Translocation t(X;21)(q25-26;q22) with ELF4. -
Sequence similarities
Belongs to the ETS family.
Contains 1 ETS DNA-binding domain.
Contains 1 PNT (pointed) domain. -
Cellular localization
Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab185597 has not yet been referenced specifically in any publications.