Description

  • Product name

    Recombinant Human ERG protein
  • Purity

    > 90 % SDS-PAGE.
    ab185597 was expressed in E. coli as inclusion bodies, refolded using temperature shift inclusion body refolding technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGSASTIKEALSVVSEDQSLFECAYG TPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMECNPSQ VNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERR VIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKD DFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNT GGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQ PSPSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDS SNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYD KNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAH PQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSH LGTYYLEESGGGGSPGRRRRRRRRRRR
    • Predicted molecular weight

      59 kDa including tags
    • Amino acids

      2 to 479
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Contructed with a T7-His-TEV cleavage site Tag (27 amino acids) fusion at the N-terminal and 11R tag at the C-terminal.

Specifications

Our Abpromise guarantee covers the use of ab185597 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    1. May be used for in vitro ERG mediated HSC differentiation regulation study using either 11R mediated or “ProFectin” based intracellular delivery of this protein.

    2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.

    3. May be used for EGR protein-protein interaction mapping.

    4. Potential diagnostic biomarker protein for monitoring various cancer treatment outcomes.

    5. As immunogen for specific antibody production.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8
    Constituent: 0.32% Tris HCl

    Contains NACl, EDTA, KCl, arginine, DTT and glycerol

General Info

  • Alternative names

    • Avian erythroblastosis virus E-26 (v-ets) oncogene related
    • D030036I24Rik
    • Erg
    • Erg 3
    • ERG/EWS fusion gene, included
    • ERG/FUS fusion gene, included
    • ERG/TMPSSR2 fusion gene, included
    • ERG_HUMAN
    • ERG1, included
    • ERG2, included
    • ets related
    • ETS-related gene
    • KCNH2
    • Oncogene ERG
    • p55
    • TMPRSS2/ERG fusion
    • Transcriptional regulator ERG
    • transcriptional regulator ERG (transforming protein ERG)
    • Transforming protein ERG
    • v ets avian erythroblastosis virus E26 oncogene
    • v ets avian erythroblastosis virus E26 oncogene related
    • v ets erythroblastosis virus E26 oncogene homolog
    • v ets erythroblastosis virus E26 oncogene like
    • v ets erythroblastosis virus E26 oncogene like isoform 2
    • v-ets erythroblastosis virus E26 oncogene
    • v-ets erythroblastosis virus E26 oncogene homolog (avian)
    • V-ets erythroblastosis virus E26 oncogene like (Avian), isoform CRA_e
    see all
  • Function

    Transcriptional regulator. May participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.
  • Involvement in disease

    Defects in ERG are a cause of Ewing sarcoma (ES) [MIM:612219]. A highly malignant, metastatic, primitive small round cell tumor of bone and soft tissue that affects children and adolescents. It belongs to the Ewing sarcoma family of tumors, a group of morphologically heterogeneous neoplasms that share the same cytogenetic features. They are considered neural tumors derived from cells of the neural crest. Ewing sarcoma represents the less differentiated form of the tumors. Note=A chromosomal aberration involving ERG is found in patients with Erwing sarcoma. Translocation t(21;22)(q22;q12) with EWSR1.
    Note=Chromosomal aberrations involving ERG have been found in acute myeloid leukemia (AML). Translocation t(16;21)(p11;q22) with FUS. Translocation t(X;21)(q25-26;q22) with ELF4.
  • Sequence similarities

    Belongs to the ETS family.
    Contains 1 ETS DNA-binding domain.
    Contains 1 PNT (pointed) domain.
  • Cellular localization

    Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt

References

ab185597 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185597.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up