Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSELQYYL TTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVE HNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEA EDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQ VYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLS FGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQF SVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHFLTGVCA IIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT
    • Molecular weight

      70 kDa including tags
    • Amino acids

      1 to 383

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2310015B14Rik
    • AV318804
    • C20orf47
    • CGI 54
    • D2Ucla1
    • dJ477O4.2
    • DKFZp547A2190
    • Endoplasmic reticulum Golgi intermediate compartment protein 3
    • endoplasmic reticulum localized protein ERp43
    • Endoplasmic reticulum-Golgi intermediate compartment protein 3
    • ERGI3_HUMAN
    • ERGIC and golgi 3
    • ergic3
    • ERV46
    • NY BR 84
    • PRO0989
    • RP23-220D12.2
    • RP3-477O4.1
    • SDBCAG84
    • Serologically defined breast cancer antigen 84
    • Serologically defined breast cancer antigen NY BR 84
    • Serologically defined breast cancer antigen NY-BR-84
    see all
  • Function

    Possible role in transport between endoplasmic reticulum and Golgi.
  • Sequence similarities

    Belongs to the ERGIC family.
  • Cellular localization

    Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus > cis-Golgi network membrane. Endoplasmic reticulum membrane. Cycles between the endoplasmic reticulum and the Golgi.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132697 stained with Coomassie Blue.

References

ab132697 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up